(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE246

CAGLA1_12.PE246      Location/Qualifiers
FT   CDS             605540..606652
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247937" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438959"
FT                   /locus_tag="CAGL0M05687g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="hydrolase activity"
FT                   /function="metal ion binding"
FT                   /protein_id="CAG62569.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG124071"
FT                   /db_xref="HOGENOM:HBG397583"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniParc:UPI00003B70D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJK1"
FT                   /transl_table=1
FT                   /translation="MSTFFGDVGLNRVSFLREDTEFIKLAFTSSEAKFIVFVNGEAFYD
FT                   ISSDGKPQLHIETSTSLKGIITTLSPLLETKDLRVDVSGVSITFLGLDDRIDGFSYKGK
FT                   YKGAPYFGLEFKVDDKTLLTPKDIEFTTSLQRMDRESLFMIDNHSATLYSHAKMYLDWL
FT                   NKYKFCPGCGSVIYPVHGGTKLQCSSAPEVNCNVRNARVNNVCFPRSDPVIIIAMANED
FT                   YSKICLARSFRKHGNFVMYSTIAGFMEPGESIENACAREIWEETGVHCDVDNVKIISSQ
FT                   PWPYPANLMIGCLGIVKFNNKDEIIDLGNDPELMDAQWFDTNEVRAAMDSYKTGWLVPF
FT                   KDEINFPGETAIAHHLIRHVCKQHQRLQKL"
     MSTFFGDVGL NRVSFLREDT EFIKLAFTSS EAKFIVFVNG EAFYDISSDG KPQLHIETST        60
     SLKGIITTLS PLLETKDLRV DVSGVSITFL GLDDRIDGFS YKGKYKGAPY FGLEFKVDDK       120
     TLLTPKDIEF TTSLQRMDRE SLFMIDNHSA TLYSHAKMYL DWLNKYKFCP GCGSVIYPVH       180
     GGTKLQCSSA PEVNCNVRNA RVNNVCFPRS DPVIIIAMAN EDYSKICLAR SFRKHGNFVM       240
     YSTIAGFMEP GESIENACAR EIWEETGVHC DVDNVKIISS QPWPYPANLM IGCLGIVKFN       300
     NKDEIIDLGN DPELMDAQWF DTNEVRAAMD SYKTGWLVPF KDEINFPGET AIAHHLIRHV       360
     CKQHQRLQKL                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page