(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE251

CAGLA1_12.PE251      Location/Qualifiers
FT   CDS             613807..614760
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196065"
FT                   /locus_tag="CAGL0M05797g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="CAG62574.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="HOGENOM:HBG124072"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020094"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI00003B70D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJJ6"
FT                   /transl_table=1
FT                   /translation="MALVLGYLGTGYQGIQYNPPAHTIDNELFKALVATNCISQSNSDD
FT                   FSKSSFSRATRTDKGVHALTNLVALKMQRYEVPQQVKAELNEILPDDIRIWDVVPVKKK
FT                   FNARVMAGTRHYRYVIPTFLLQCGPHSDLSTSQLARFKNIWNMFLGTHNYYNFTPRRKD
FT                   TNADSPQNMRHMYSIQVSDPFTIAGSTQWLSIAIHGQSFLLHQIRKMVHYALSEYHRSS
FT                   SDTKSMELLETVDPDLTSATALDTPTEQYIPLAPAAGLYLHHPTFEGYNNQPAARRLQV
FT                   LDLSGYPACATFEDRIHTEIARSEHVFHEYMAVIRQ"
     MALVLGYLGT GYQGIQYNPP AHTIDNELFK ALVATNCISQ SNSDDFSKSS FSRATRTDKG        60
     VHALTNLVAL KMQRYEVPQQ VKAELNEILP DDIRIWDVVP VKKKFNARVM AGTRHYRYVI       120
     PTFLLQCGPH SDLSTSQLAR FKNIWNMFLG THNYYNFTPR RKDTNADSPQ NMRHMYSIQV       180
     SDPFTIAGST QWLSIAIHGQ SFLLHQIRKM VHYALSEYHR SSSDTKSMEL LETVDPDLTS       240
     ATALDTPTEQ YIPLAPAAGL YLHHPTFEGY NNQPAARRLQ VLDLSGYPAC ATFEDRIHTE       300
     IARSEHVFHE YMAVIRQ                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page