(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE253

CAGLA1_12.PE253      Location/Qualifiers
FT   CDS             615972..617207
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438961"
FT                   /locus_tag="CAGL0M05841g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="glycolipid 2-alpha-mannosyltransferase activity "
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62576.1"
FT                   /db_xref="GO:0004377"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG192431"
FT                   /db_xref="HOGENOM:HBG396033"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="UniParc:UPI00003B70D9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJJ4"
FT                   /transl_table=1
FT                   /translation="MKEWLIWVVEVFIWWGQLWFCGDIDRNYFERSVAVKTKYDGVRRR
FT                   EYFVPLKLATNSYDDMAVFTELEYSPKRENATLLMLVRNWELSGALASMRSLEDRFNRK
FT                   YNYDWVFLNDVPFDEDFMLATSAMASGMTYYGMVPPHEWSTPTWINEDQYAQCLRDMEG
FT                   SGVIYGGSRSYRNMCRFYSGFFYKQDLLKNYDYYMRVEPNVEYFCDFPYDPFKVMRANK
FT                   YKYGFLMSLYEYENTIPHLWHAVEDYINEYGHKLNFENNSYSFLVDKDHFSPNTMGIIE
FT                   SHTDYNLCHFWSNFEVGDLSFFRSKEYEEFFDFMDQKGGFYYERWGDAPIHTIAASLLL
FT                   NTSEVIHFDELGYRHEPYLSCPRSLGIQLQQRCLCDVNSDVNLDISLASCLPRWWRNGS
FT                   GKTFVKPKQFTD"
     MKEWLIWVVE VFIWWGQLWF CGDIDRNYFE RSVAVKTKYD GVRRREYFVP LKLATNSYDD        60
     MAVFTELEYS PKRENATLLM LVRNWELSGA LASMRSLEDR FNRKYNYDWV FLNDVPFDED       120
     FMLATSAMAS GMTYYGMVPP HEWSTPTWIN EDQYAQCLRD MEGSGVIYGG SRSYRNMCRF       180
     YSGFFYKQDL LKNYDYYMRV EPNVEYFCDF PYDPFKVMRA NKYKYGFLMS LYEYENTIPH       240
     LWHAVEDYIN EYGHKLNFEN NSYSFLVDKD HFSPNTMGII ESHTDYNLCH FWSNFEVGDL       300
     SFFRSKEYEE FFDFMDQKGG FYYERWGDAP IHTIAASLLL NTSEVIHFDE LGYRHEPYLS       360
     CPRSLGIQLQ QRCLCDVNSD VNLDISLASC LPRWWRNGSG KTFVKPKQFT D                411
//

If you have problems or comments...

PBIL Back to PBIL home page