(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE255

CAGLA1_12.PE255      Location/Qualifiers
FT   CDS             complement(620069..621535)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113285" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196067"
FT                   /locus_tag="CAGL0M05885g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62578.1"
FT                   /db_xref="HOGENOM:HBG124074"
FT                   /db_xref="InterPro:IPR007174"
FT                   /db_xref="UniParc:UPI00003B70DB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJJ2"
FT                   /transl_table=1
FT                   /translation="MSHGRVVPWKDEKELDELKQWFYSVSDGNDLRLKAISRVKSYKLK
FT                   GSQYLPHVIDSTAQLTSAILADEKHGGSDDLFDKMNIRMTYTMAMIRFVNGVLDPSQQT
FT                   QFAIPLHTIARNVGLPSWFVDLRHWGTHERDLPNIDMLRMAAKDALQWLWKNYWDNDEL
FT                   DDSLNEDDALDEETIRQQEYLDRLRLKIELWKNNNTELRDNCNIWLEEKNSIISSDNFV
FT                   VDDGGKTNSSKADQLVKFIDETITEVKYLWKVIRDKNLFMRTFLKFYDDLFLSLLVRKL
FT                   PGFDLELIKWMFSAYTVLYQDGNLELKQDLYAIRSRFSKWIVLEKELLSPLVSLLNIRS
FT                   RISELSELFNPDMTFMQFKLLSLLVKKLEEDIGNHNWRRKKRRKDNNDTTAKLNDTQRQ
FT                   WNQLVADYLKSHVMLEEEKQFSMYGAKAKAVVKKAKEASVHNNELSDDLQKLKQRLLNL
FT                   KSKESVKPPSIETFNWDSHDDWQPKPFGIL"
     MSHGRVVPWK DEKELDELKQ WFYSVSDGND LRLKAISRVK SYKLKGSQYL PHVIDSTAQL        60
     TSAILADEKH GGSDDLFDKM NIRMTYTMAM IRFVNGVLDP SQQTQFAIPL HTIARNVGLP       120
     SWFVDLRHWG THERDLPNID MLRMAAKDAL QWLWKNYWDN DELDDSLNED DALDEETIRQ       180
     QEYLDRLRLK IELWKNNNTE LRDNCNIWLE EKNSIISSDN FVVDDGGKTN SSKADQLVKF       240
     IDETITEVKY LWKVIRDKNL FMRTFLKFYD DLFLSLLVRK LPGFDLELIK WMFSAYTVLY       300
     QDGNLELKQD LYAIRSRFSK WIVLEKELLS PLVSLLNIRS RISELSELFN PDMTFMQFKL       360
     LSLLVKKLEE DIGNHNWRRK KRRKDNNDTT AKLNDTQRQW NQLVADYLKS HVMLEEEKQF       420
     SMYGAKAKAV VKKAKEASVH NNELSDDLQK LKQRLLNLKS KESVKPPSIE TFNWDSHDDW       480
     QPKPFGIL                                                                488
//

If you have problems or comments...

PBIL Back to PBIL home page