(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE256

CAGLA1_12.PE256      Location/Qualifiers
FT   CDS             622029..624704
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349244"
FT                   /locus_tag="CAGL0M05907g"
FT                   /product="Similar to uniprot|P36023 Saccharomyces
FT                   cerevisiae YKR064w"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62579.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124075"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00003B70DC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJJ1"
FT                   /transl_table=1
FT                   /translation="MEEPKKVTKSRRRPMLVCVNCRKRKSKCDRQLPCSKCIQHGDTDT
FT                   CTYLNDVPIGKKNNVPNTQVTPNSSSPSIVINLHQNGNDYKTKNLNGQDNTLLKEINNN
FT                   IWGRNSPIFPDSSDHSPPTQVFGDGPNLKPKVIGHCRYSGENQYINMVPKGYLIEVKRS
FT                   SVTRYAMWTSTSVEYRDPYLSCMLMFKKGAVKATTEQMKKKMKFKNLPNSFALFTAFDN
FT                   ADDGKDKPNLNHAKIFNKFAEYRQQKSIGDLSEDHILDTKDLPRRQAVENCVLMFAKFH
FT                   LCPLLPLFNLPHLMEEVKIFYDNVEKTGKVSTKNGDNWIYCIILLLTKICKLAICMSNI
FT                   PGDDVSPIAQLDTTRFIPLVHKYIMNHNLFRKCTLHQLQVLLLLRFYNWCAPEDGDGQQ
FT                   GQQNSILMGMIISSAKELGIGWDLFTPGFPVGIDISDGSRPSAQHMNAEEYTTLYQKIW
FT                   CYILFWDRKMLLVNGQNCIIQRSRDTDYSLLEATFSKEDGSEFFRYFIHLDSLLLEIND
FT                   LISSNPTKVNITALNNCMTSLEEEFRNIHTIVNSREILQSNDDPRFFEVSWNIKIARAC
FT                   ILHAEVVSYEKECDFVRCHYAIQKLWEIVLSMCSDCMEYWSQRSEAFLGSLNNFYTNRI
FT                   VEIAADRLVHFVKAIILRLHRFHNVKAEDKQILVQFMHKFCSLYFTNFGREYFRCFKSL
FT                   FNLKMDYRVLSYSSVKDPWTVMLTFILHEMSYGEQPEGKLSLRDRLPLIAKLHDKLSYM
FT                   PSSFKNHDLILDAWQTSIYPICRYDEHFQLNLYISEIKKLDEHYKIDKDKNLFESFYNN
FT                   EVKLFGEEFGTQESCNSAFQKDSSEPPQETITLDEWGTLSGPYEGNDILLASETDSKAL
FT                   RYNDQLIQEIFNPKDFLPFL"
     MEEPKKVTKS RRRPMLVCVN CRKRKSKCDR QLPCSKCIQH GDTDTCTYLN DVPIGKKNNV        60
     PNTQVTPNSS SPSIVINLHQ NGNDYKTKNL NGQDNTLLKE INNNIWGRNS PIFPDSSDHS       120
     PPTQVFGDGP NLKPKVIGHC RYSGENQYIN MVPKGYLIEV KRSSVTRYAM WTSTSVEYRD       180
     PYLSCMLMFK KGAVKATTEQ MKKKMKFKNL PNSFALFTAF DNADDGKDKP NLNHAKIFNK       240
     FAEYRQQKSI GDLSEDHILD TKDLPRRQAV ENCVLMFAKF HLCPLLPLFN LPHLMEEVKI       300
     FYDNVEKTGK VSTKNGDNWI YCIILLLTKI CKLAICMSNI PGDDVSPIAQ LDTTRFIPLV       360
     HKYIMNHNLF RKCTLHQLQV LLLLRFYNWC APEDGDGQQG QQNSILMGMI ISSAKELGIG       420
     WDLFTPGFPV GIDISDGSRP SAQHMNAEEY TTLYQKIWCY ILFWDRKMLL VNGQNCIIQR       480
     SRDTDYSLLE ATFSKEDGSE FFRYFIHLDS LLLEINDLIS SNPTKVNITA LNNCMTSLEE       540
     EFRNIHTIVN SREILQSNDD PRFFEVSWNI KIARACILHA EVVSYEKECD FVRCHYAIQK       600
     LWEIVLSMCS DCMEYWSQRS EAFLGSLNNF YTNRIVEIAA DRLVHFVKAI ILRLHRFHNV       660
     KAEDKQILVQ FMHKFCSLYF TNFGREYFRC FKSLFNLKMD YRVLSYSSVK DPWTVMLTFI       720
     LHEMSYGEQP EGKLSLRDRL PLIAKLHDKL SYMPSSFKNH DLILDAWQTS IYPICRYDEH       780
     FQLNLYISEI KKLDEHYKID KDKNLFESFY NNEVKLFGEE FGTQESCNSA FQKDSSEPPQ       840
     ETITLDEWGT LSGPYEGNDI LLASETDSKA LRYNDQLIQE IFNPKDFLPF L                891
//

If you have problems or comments...

PBIL Back to PBIL home page