(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE257

CAGLA1_12.PE257      Location/Qualifiers
FT   CDS             complement(624997..625557)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000213138" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196068"
FT                   /gene_name="PAM17"
FT                   /locus_tag="CAGL0M05929g"
FT                   /product="Presequence translocated-associated motor subunit
FT                   PAM17, mitochondrial"
FT                   /biological_process="protein transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG62580.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058858"
FT                   /db_xref="HOGENOM:HBG396609"
FT                   /db_xref="InterPro:IPR013875"
FT                   /db_xref="UniParc:UPI00003B70DD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJJ0"
FT                   /transl_table=1
FT                   /translation="MLSITQGIVRRSVARPGLIRPLVKCNARYYSDKPEDSLTWTDFFQ
FT                   LRKQERRINVGSSVFTALVGANVSWAYLSTMEIDPTQMIFGFDPLVVVTAGLMASGALG
FT                   YLMGPAVGSQVFKLTKGNKLAQYNLKNKEFLKHVIQNRVDASSQSFSNPVPDYYGEKIG
FT                   SVKEYRQWLRDCHAYAKKAKEFL"
     MLSITQGIVR RSVARPGLIR PLVKCNARYY SDKPEDSLTW TDFFQLRKQE RRINVGSSVF        60
     TALVGANVSW AYLSTMEIDP TQMIFGFDPL VVVTAGLMAS GALGYLMGPA VGSQVFKLTK       120
     GNKLAQYNLK NKEFLKHVIQ NRVDASSQSF SNPVPDYYGE KIGSVKEYRQ WLRDCHAYAK       180
     KAKEFL                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page