(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE258

CAGLA1_12.PE258      Location/Qualifiers
FT   CDS             626330..626719
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000001095" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044866"
FT                   /gene_name="FMP46"
FT                   /locus_tag="CAGL0M05951g"
FT                   /product="Putative redox protein FMP46, mitochondrial "
FT                   /EC_number="1.-.-.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG62581.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG059347"
FT                   /db_xref="HOGENOM:HBG202378"
FT                   /db_xref="HSSP:1WPI"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR012882"
FT                   /db_xref="UniParc:UPI00003B70DE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJI9"
FT                   /transl_table=1
FT                   /translation="MSMFRTLQRQPRTISLFTHDLENSRPCLSILEYLKSHTTNRFDLE
FT                   LSTKFPTLDQVHYMNAINPMILRAQIPHLTKIMKLKSYDPLFGSQLSDCVTKGFWNKEA
FT                   PLWVDWEKKALGTDLQSIKELLEKD"
     MSMFRTLQRQ PRTISLFTHD LENSRPCLSI LEYLKSHTTN RFDLELSTKF PTLDQVHYMN        60
     AINPMILRAQ IPHLTKIMKL KSYDPLFGSQ LSDCVTKGFW NKEAPLWVDW EKKALGTDLQ       120
     SIKELLEKD                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page