(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE259

CAGLA1_12.PE259      Location/Qualifiers
FT   CDS             627289..628521
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171827" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438963"
FT                   /locus_tag="CAGL0M05973g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62582.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG390350"
FT                   /db_xref="HOGENOM:HBG619916"
FT                   /db_xref="InterPro:IPR002164"
FT                   /db_xref="UniParc:UPI00003B70DF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJI8"
FT                   /transl_table=1
FT                   /translation="MSAPIKTKPKSSMKIDNAPTPHNTPASVLNNSYLKNGNPVGKSKP
FT                   PPTISEEDIQTALSSQQPLLLGAIQEKLGSLVGQDSGYVDSLPQVVRNRIFALKKLQSD
FT                   LFGIEKDFQVELFELEHKYLQKYAPLHARRSEIISGKQEPTSEEVAAGKEIQEKEEGEE
FT                   EEGEKPTDIQLTEEDIKGIPSFWLTALENLPIVSDTITDRDAEVLEYLQDVSIEYLTEG
FT                   KPGFLLKFKFSEENPYFKTPELTKTYYYQSELGYSGDFIYDHADGCSIDWVDNDSNVTI
FT                   AVEMRKQRNKTTKQVRTIEKITPIESFFNFFDPPKMAGDEEDEEDLEDLEERLALDYSI
FT                   GEQIKDKLIPRAVDWFTGAALEFEFNDAPEDEFDEFEDEDEDEDEDEEEDEDERDDFAN
FT                   KKEEPPECKQS"
     MSAPIKTKPK SSMKIDNAPT PHNTPASVLN NSYLKNGNPV GKSKPPPTIS EEDIQTALSS        60
     QQPLLLGAIQ EKLGSLVGQD SGYVDSLPQV VRNRIFALKK LQSDLFGIEK DFQVELFELE       120
     HKYLQKYAPL HARRSEIISG KQEPTSEEVA AGKEIQEKEE GEEEEGEKPT DIQLTEEDIK       180
     GIPSFWLTAL ENLPIVSDTI TDRDAEVLEY LQDVSIEYLT EGKPGFLLKF KFSEENPYFK       240
     TPELTKTYYY QSELGYSGDF IYDHADGCSI DWVDNDSNVT IAVEMRKQRN KTTKQVRTIE       300
     KITPIESFFN FFDPPKMAGD EEDEEDLEDL EERLALDYSI GEQIKDKLIP RAVDWFTGAA       360
     LEFEFNDAPE DEFDEFEDED EDEDEDEEED EDERDDFANK KEEPPECKQS                  410
//

If you have problems or comments...

PBIL Back to PBIL home page