(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE26

CAGLA1_12.PE26       Location/Qualifiers
FT   CDS             complement(79782..81101)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000142328" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436689"
FT                   /locus_tag="CAGL0M00682g"
FT                   /product="Similar to uniprot|Q06204 Saccharomyces
FT                   cerevisiae YLR446w"
FT                   /function="ATP binding"
FT                   /function="kinase activity"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /biological_process="glycolysis"
FT                   /protein_id="CAG62351.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG059104"
FT                   /db_xref="HOGENOM:HBG202599"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="InterPro:IPR022672"
FT                   /db_xref="UniParc:UPI00003B6FFA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK69"
FT                   /transl_table=1
FT                   /translation="MRPIGTMTIANPEKILEEVKSQLGVRQSLATITEKFQEELDFMLK
FT                   NCKKSMLPFPQVCCRGWSEYNEPMDMLAIDFGGSVLKFAVINMPQCQMELKYELEIKSK
FT                   VVDFKFFDNIVEWICNRIPINNERSLPRKFIVAITFSFPVNANNEIVAMGKGFRMSPEL
FT                   KGISILDILKQSFDRLEKEYSSSFTFEISNVINDSLAVHMTSKYLQSDNNDKISLILGT
FT                   GVNSCFEVQYEDLPQFKKDILTQFSDDYREKVLINSEMGFLGRYSKSIEFGNFDTNIDD
FT                   KMPLESITSGKWIPQILHNIIRYYNLLPMVGDEEIKYDGRLICEILSDGECPSEYLLSL
FT                   WDYEVYQIIRQITKLLINRAAIYLVAAIIAIRKFVSPEIYFTKGGIDIDYVGSFLNYCQ
FT                   YYQERIHLHSKGMVKLQFLNDSNLYGCAITAYSNIFENRI"
     MRPIGTMTIA NPEKILEEVK SQLGVRQSLA TITEKFQEEL DFMLKNCKKS MLPFPQVCCR        60
     GWSEYNEPMD MLAIDFGGSV LKFAVINMPQ CQMELKYELE IKSKVVDFKF FDNIVEWICN       120
     RIPINNERSL PRKFIVAITF SFPVNANNEI VAMGKGFRMS PELKGISILD ILKQSFDRLE       180
     KEYSSSFTFE ISNVINDSLA VHMTSKYLQS DNNDKISLIL GTGVNSCFEV QYEDLPQFKK       240
     DILTQFSDDY REKVLINSEM GFLGRYSKSI EFGNFDTNID DKMPLESITS GKWIPQILHN       300
     IIRYYNLLPM VGDEEIKYDG RLICEILSDG ECPSEYLLSL WDYEVYQIIR QITKLLINRA       360
     AIYLVAAIIA IRKFVSPEIY FTKGGIDIDY VGSFLNYCQY YQERIHLHSK GMVKLQFLND       420
     SNLYGCAITA YSNIFENRI                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page