(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE261

CAGLA1_12.PE261      Location/Qualifiers
FT   CDS             complement(630670..632010)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163305" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438965"
FT                   /locus_tag="CAGL0M06017g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="binding"
FT                   /function="prephenate dehydrogenase (NADP+) activity "
FT                   /biological_process="tyrosine biosynthetic process "
FT                   /protein_id="CAG62584.1"
FT                   /db_xref="GO:0004665"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006571"
FT                   /db_xref="HOGENOM:HBG053009"
FT                   /db_xref="HOGENOM:HBG330953"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012385"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00003B70E1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJI6"
FT                   /transl_table=1
FT                   /translation="MMEEQWQANKVIGIIGLGDMGLLYATKFSSAGWKVVACDREELFD
FT                   SLSERKRQNAWKFDIVKNGHYVSRISDYIIYSVEAENIDKLVKLYGPSTKVGAIVGGQT
FT                   SCKTPEIKAFEKYLPEDVEIITLHSLHGPKVNTEGQPLVLINHRSKTDESMKFIESLVS
FT                   CLKSKQVYLTYEEHDRITADTQAVTHAAFLSMGRAWAKLKVYPWTLGVNKWYGGLENVK
FT                   VNISLRIYSNKWHVYAGLALTNPMAHKQILQYATSATELFTLFLDKKKDELTERLNKAK
FT                   EFVFGNHTGLLLLDDTIFEKYSLSKDSASSDSKESTSLPNSHLSLLAIVDSWHQLGINP
FT                   YDHMICSTPLFRIFLGVSEFLFLSPDLLEKTIDAAIDDHSFRRDDLEFVVAAREWSSIV
FT                   TFGNFDLYKRQFEDVQKFFEPMLPEANQIGNEMIKTILMHSQDSKEA"
     MMEEQWQANK VIGIIGLGDM GLLYATKFSS AGWKVVACDR EELFDSLSER KRQNAWKFDI        60
     VKNGHYVSRI SDYIIYSVEA ENIDKLVKLY GPSTKVGAIV GGQTSCKTPE IKAFEKYLPE       120
     DVEIITLHSL HGPKVNTEGQ PLVLINHRSK TDESMKFIES LVSCLKSKQV YLTYEEHDRI       180
     TADTQAVTHA AFLSMGRAWA KLKVYPWTLG VNKWYGGLEN VKVNISLRIY SNKWHVYAGL       240
     ALTNPMAHKQ ILQYATSATE LFTLFLDKKK DELTERLNKA KEFVFGNHTG LLLLDDTIFE       300
     KYSLSKDSAS SDSKESTSLP NSHLSLLAIV DSWHQLGINP YDHMICSTPL FRIFLGVSEF       360
     LFLSPDLLEK TIDAAIDDHS FRRDDLEFVV AAREWSSIVT FGNFDLYKRQ FEDVQKFFEP       420
     MLPEANQIGN EMIKTILMHS QDSKEA                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page