(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE262

CAGLA1_12.PE262      Location/Qualifiers
FT   CDS             complement(632430..632798)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248080" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438966"
FT                   /locus_tag="CAGL0M06039g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAG62585.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG060005"
FT                   /db_xref="HOGENOM:HBG397189"
FT                   /db_xref="InterPro:IPR002775"
FT                   /db_xref="InterPro:IPR020241"
FT                   /db_xref="UniParc:UPI00003B70E2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJI5"
FT                   /transl_table=1
FT                   /translation="MAEKLVRKLPTVKTMSHKKIKSTMYVKSGTPFKSATKRIDKLLNQ
FT                   CQRYVTVLGMGHSVTKTLAIATTYQEKLHKVQVMTKTIEVLDEVVEDTESIDDSDSDIE
FT                   TKLKKRLLSGVEVRIFKV"
     MAEKLVRKLP TVKTMSHKKI KSTMYVKSGT PFKSATKRID KLLNQCQRYV TVLGMGHSVT        60
     KTLAIATTYQ EKLHKVQVMT KTIEVLDEVV EDTESIDDSD SDIETKLKKR LLSGVEVRIF       120
     KV                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page