(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE264

CAGLA1_12.PE264      Location/Qualifiers
FT   CDS             complement(634963..637047)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000228138" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196069"
FT                   /gene_name="SSE1"
FT                   /locus_tag="CAGL0M06083g"
FT                   /product="Heat shock protein homolog SSE1 "
FT                   /function="ATP binding"
FT                   /biological_process="response to stress"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG62587.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG315155"
FT                   /db_xref="HOGENOM:HBG396971"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniParc:UPI00003B70E4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJI3"
FT                   /transl_table=1
FT                   /translation="MSTPFGLDFGNDNSVLAVARNRGIDIVVNEVSNRSTPSMVGFGQK
FT                   NRFLGESAKTKQTSNIKNTVGNLKRILGLDYDHPDFQEESKFFTSKLVKLEDGKIGTQV
FT                   RFAGESTTFSATQLNAMFINKVKQTVETETKANITDVCIAVPTWYTEEQRYAAADAARI
FT                   AGLNPVRIVNDITAAGVSYGVFKTDLPEGEEKPRIVAFIDIGHSSYTCSIMAFKKGELK
FT                   VLGTAWDKNFGGRNFDRAITEHFADEFKTKYKIDIRENPKAYNRVMTSAERLKKVLSAN
FT                   TAAPFSVENVMNDVDASSQLSREELEELVKPMLERVTEPVTKALAQAGLTKDDVDFVEI
FT                   IGGTTRIPTLKNSISEAFGKPLSTTLNQDEAIAKGAAFICAIHSPTLRVRPFKFEDIHQ
FT                   FSVSYKWDKQVEDEDHLEVFPANSNFPSTKLITLHRSGDFSMEANYTNKEELPPHLDAN
FT                   IAKWDITGVQIPEGETSVPVKLKLRCDPSGLHIIEEAYSLEDIVVKEEVPLPEDAPEDA
FT                   VPEVKEVTKTVKKDTLEITAHTFTLADDKLNTLIEKENDMTAQDRLVAETEDRKNNLEE
FT                   YIYTLRGKLDEEYSDFASDAEKTKLKDMLAKAEEWLYEDGFDTIKAKYIAKYEELAAIG
FT                   NVIRGRYLAKEEEKKQALRAKQEAANLAALSEKLAAQRSADSEAKKDATPEGDAQMDLD
FT                   "
     MSTPFGLDFG NDNSVLAVAR NRGIDIVVNE VSNRSTPSMV GFGQKNRFLG ESAKTKQTSN        60
     IKNTVGNLKR ILGLDYDHPD FQEESKFFTS KLVKLEDGKI GTQVRFAGES TTFSATQLNA       120
     MFINKVKQTV ETETKANITD VCIAVPTWYT EEQRYAAADA ARIAGLNPVR IVNDITAAGV       180
     SYGVFKTDLP EGEEKPRIVA FIDIGHSSYT CSIMAFKKGE LKVLGTAWDK NFGGRNFDRA       240
     ITEHFADEFK TKYKIDIREN PKAYNRVMTS AERLKKVLSA NTAAPFSVEN VMNDVDASSQ       300
     LSREELEELV KPMLERVTEP VTKALAQAGL TKDDVDFVEI IGGTTRIPTL KNSISEAFGK       360
     PLSTTLNQDE AIAKGAAFIC AIHSPTLRVR PFKFEDIHQF SVSYKWDKQV EDEDHLEVFP       420
     ANSNFPSTKL ITLHRSGDFS MEANYTNKEE LPPHLDANIA KWDITGVQIP EGETSVPVKL       480
     KLRCDPSGLH IIEEAYSLED IVVKEEVPLP EDAPEDAVPE VKEVTKTVKK DTLEITAHTF       540
     TLADDKLNTL IEKENDMTAQ DRLVAETEDR KNNLEEYIYT LRGKLDEEYS DFASDAEKTK       600
     LKDMLAKAEE WLYEDGFDTI KAKYIAKYEE LAAIGNVIRG RYLAKEEEKK QALRAKQEAA       660
     NLAALSEKLA AQRSADSEAK KDATPEGDAQ MDLD                                   694
//

If you have problems or comments...

PBIL Back to PBIL home page