(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE265

CAGLA1_12.PE265      Location/Qualifiers
FT   CDS             complement(637479..639221)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000008139" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501418"
FT                   /gene_name="NPL4"
FT                   /locus_tag="CAGL0M06105g"
FT                   /product="Nuclear protein localization protein 4 "
FT                   /biological_process="mRNA transport"
FT                   /biological_process="protein transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="nuclear membrane"
FT                   /cellular_component="perinuclear region of cytoplasm "
FT                   /protein_id="CAG62588.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0031965"
FT                   /db_xref="GO:0048471"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG051418"
FT                   /db_xref="HOGENOM:HBG330015"
FT                   /db_xref="InterPro:IPR007716"
FT                   /db_xref="InterPro:IPR007717"
FT                   /db_xref="InterPro:IPR016563"
FT                   /db_xref="UniParc:UPI00003B70E5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJI2"
FT                   /transl_table=1
FT                   /translation="MIIRFRSPVGMHRVRCEGSETLGQVLPQLQTILNEHGITPRAIEL
FT                   GKEANGKDKTNVESLLEKTIEALGFRHGDIVYVHYQVDSSETKGSANDNNGSVAVNIPN
FT                   NLVPGKSQKADELEVDKELEKLDGLIPRQKTKLCKHGDRGMCEYCSPLPPWDANYANEN
FT                   NIKHISFHAYLKKLNESTNKRESGSSYIAPLSQPNFKINKHCTNGHEPWPKGICSKCQP
FT                   SAITLQQQEFRMVDHVEFQSSELINQFIEFWRASGTQRFAYLYGKYEKYDATPLGIKAC
FT                   VHAIYEPPQHDEQDGITMDMEQVTQELNTIDLLAKEMGLLRVGMIFSDLTDAGNGDGTV
FT                   LCKRHKDSFFLSSLETIMAAQHQTRHPNVSKFSEQGIFSSKFVTCVVSGNLKEEIDIAS
FT                   YQVSIDAEALVSADMIGGSTHPSMAYINDTTEDRYVPEIFYMKKNEYGLTVKENAKPAF
FT                   PVDYLIVSLTHGFPKDEDTTTQLFNSVTGFPWSNRQAMGYSQDYHELKRYLHSTAASGN
FT                   FNDLHDKLANFHLLLYIHSLQILSQEEWELLVKGALSQDYQEPLYKLSASPGWQTLLMI
FT                   IESA"
     MIIRFRSPVG MHRVRCEGSE TLGQVLPQLQ TILNEHGITP RAIELGKEAN GKDKTNVESL        60
     LEKTIEALGF RHGDIVYVHY QVDSSETKGS ANDNNGSVAV NIPNNLVPGK SQKADELEVD       120
     KELEKLDGLI PRQKTKLCKH GDRGMCEYCS PLPPWDANYA NENNIKHISF HAYLKKLNES       180
     TNKRESGSSY IAPLSQPNFK INKHCTNGHE PWPKGICSKC QPSAITLQQQ EFRMVDHVEF       240
     QSSELINQFI EFWRASGTQR FAYLYGKYEK YDATPLGIKA CVHAIYEPPQ HDEQDGITMD       300
     MEQVTQELNT IDLLAKEMGL LRVGMIFSDL TDAGNGDGTV LCKRHKDSFF LSSLETIMAA       360
     QHQTRHPNVS KFSEQGIFSS KFVTCVVSGN LKEEIDIASY QVSIDAEALV SADMIGGSTH       420
     PSMAYINDTT EDRYVPEIFY MKKNEYGLTV KENAKPAFPV DYLIVSLTHG FPKDEDTTTQ       480
     LFNSVTGFPW SNRQAMGYSQ DYHELKRYLH STAASGNFND LHDKLANFHL LLYIHSLQIL       540
     SQEEWELLVK GALSQDYQEP LYKLSASPGW QTLLMIIESA                             580
//

If you have problems or comments...

PBIL Back to PBIL home page