(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE266

CAGLA1_12.PE266      Location/Qualifiers
FT   CDS             640057..640749
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000728" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349245"
FT                   /locus_tag="CAGL0M06127g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62589.1"
FT                   /db_xref="HOGENOM:HBG060002"
FT                   /db_xref="HOGENOM:HBG396992"
FT                   /db_xref="InterPro:IPR018624"
FT                   /db_xref="UniParc:UPI00003B70E6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJI1"
FT                   /transl_table=1
FT                   /translation="MDQEFFNATDFNGTNGTQFENNGTRFDNGTHGNGTFFEEPQVEMK
FT                   AVSFYTPLLYVSLLVISLFIFASQYRKNKIKKISELPSIFDESDAKDLYMDLLKLQKSG
FT                   DKKIHEKVLKAGLLNRCAEAIRRSLKLKEMAPQVEILYKNGSIGDDYWQRYQTEVKLVD
FT                   VEFKECIQESERLQPGWVPTFVPLAREICLNQALSRRYNAIATRREVCIEEWGLKLDKD
FT                   GKLISSKN"
     MDQEFFNATD FNGTNGTQFE NNGTRFDNGT HGNGTFFEEP QVEMKAVSFY TPLLYVSLLV        60
     ISLFIFASQY RKNKIKKISE LPSIFDESDA KDLYMDLLKL QKSGDKKIHE KVLKAGLLNR       120
     CAEAIRRSLK LKEMAPQVEI LYKNGSIGDD YWQRYQTEVK LVDVEFKECI QESERLQPGW       180
     VPTFVPLARE ICLNQALSRR YNAIATRREV CIEEWGLKLD KDGKLISSKN                  230
//

If you have problems or comments...

PBIL Back to PBIL home page