(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE267

CAGLA1_12.PE267      Location/Qualifiers
FT   CDS             complement(640964..642556)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196070"
FT                   /locus_tag="CAGL0M06149g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62590.1"
FT                   /db_xref="HOGENOM:HBG124077"
FT                   /db_xref="InterPro:IPR003169"
FT                   /db_xref="UniParc:UPI00003B70E7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJI0"
FT                   /transl_table=1
FT                   /translation="MDFSSSQKYIQTQTLLDNINGLQNLHVQDREGSKNNLTYAKNAAS
FT                   DVDGSQPLLNTDMIFKANNKNHTRYIDNTGILPDFSAHSSGNLNDLHAELSSPFYNIPT
FT                   IQNTTDMFDSHSHVSKTPLSIHQDVGTPTPTNKNSKVMETYGFVNTFLSPPVWRYIDIQ
FT                   GNTQGPFSSSDMTGWYLQGYFQPTLQLFRDSTSHDNSNSTSQMCNQLITLMDILNHTQN
FT                   YQDPFNKFDEMLMTKTPVTEMVNPIPNHINNNAVTLAEECSNKDVNIESQIVESSIQKE
FT                   DVQAIASKHNAIENTTLEKPKLPSLMESHTNSINNLNNTTKESSTTISIGGSNLNKQKS
FT                   FTSSNQSQLRNDEKYNGENTTRNSSNKWSEIAKKNAPQNNPVAPVQKKTIAVQKTSLTT
FT                   AKSTEIDEKKTLLSATEPISIVNEDPQLSVDEFFFWCRKQIKLNDGHSLKDVLELILSL
FT                   PTDSESESIISETIYASSDTMDGRRFTKEFNQKRRECEKSNSGIQLTELVSSYITDEDD
FT                   WDFQVVNRKGKKN"
     MDFSSSQKYI QTQTLLDNIN GLQNLHVQDR EGSKNNLTYA KNAASDVDGS QPLLNTDMIF        60
     KANNKNHTRY IDNTGILPDF SAHSSGNLND LHAELSSPFY NIPTIQNTTD MFDSHSHVSK       120
     TPLSIHQDVG TPTPTNKNSK VMETYGFVNT FLSPPVWRYI DIQGNTQGPF SSSDMTGWYL       180
     QGYFQPTLQL FRDSTSHDNS NSTSQMCNQL ITLMDILNHT QNYQDPFNKF DEMLMTKTPV       240
     TEMVNPIPNH INNNAVTLAE ECSNKDVNIE SQIVESSIQK EDVQAIASKH NAIENTTLEK       300
     PKLPSLMESH TNSINNLNNT TKESSTTISI GGSNLNKQKS FTSSNQSQLR NDEKYNGENT       360
     TRNSSNKWSE IAKKNAPQNN PVAPVQKKTI AVQKTSLTTA KSTEIDEKKT LLSATEPISI       420
     VNEDPQLSVD EFFFWCRKQI KLNDGHSLKD VLELILSLPT DSESESIISE TIYASSDTMD       480
     GRRFTKEFNQ KRRECEKSNS GIQLTELVSS YITDEDDWDF QVVNRKGKKN                  530
//

If you have problems or comments...

PBIL Back to PBIL home page