(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE268

CAGLA1_12.PE268      Location/Qualifiers
FT   CDS             complement(643102..643542)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175329" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438968"
FT                   /locus_tag="CAGL0M06171g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62591.1"
FT                   /db_xref="HOGENOM:HBG059999"
FT                   /db_xref="HOGENOM:HBG325020"
FT                   /db_xref="InterPro:IPR008012"
FT                   /db_xref="UniParc:UPI00003B70E8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJH9"
FT                   /transl_table=1
FT                   /translation="MSIVPKGHQDRVSTSQGVTSNAASLPDTLRMQEGGAVPLSSQLND
FT                   RHPLMHRVQNWEETQHRRQLEQYRNIFGLAEPMRRMMEIGIVDATDFNPVSQGQSSIHR
FT                   DILMNKETSVDWEDIYPENNGLLSGNMVGDDVHTQIERKVGI"
     MSIVPKGHQD RVSTSQGVTS NAASLPDTLR MQEGGAVPLS SQLNDRHPLM HRVQNWEETQ        60
     HRRQLEQYRN IFGLAEPMRR MMEIGIVDAT DFNPVSQGQS SIHRDILMNK ETSVDWEDIY       120
     PENNGLLSGN MVGDDVHTQI ERKVGI                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page