(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE271

CAGLA1_12.PE271      Location/Qualifiers
FT   CDS             complement(646413..647774)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248589" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438970"
FT                   /locus_tag="CAGL0M06237g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="carboxylesterase activity"
FT                   /protein_id="CAG62594.1"
FT                   /db_xref="GO:0004091"
FT                   /db_xref="HOGENOM:HBG058437"
FT                   /db_xref="HOGENOM:HBG395376"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000952"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="UniParc:UPI00003B70EB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJH6"
FT                   /transl_table=1
FT                   /translation="MSVNTWPLINPFNWGYNGTIKHVTHDEGTVKLQLKNGEEPLQFEE
FT                   FLNKYVPELKNDAKFKLNPALFTGILQTMYLGSADYSREFQVFYGREIVKFSDGGVCTV
FT                   DYVMKDWENEYKLNETTKKFDVEKFKQDEADTHAEGWPRLQPRTRYLRDNELQEVHSDD
FT                   RPLVLVLHGLAGGSHEPVIRSLTQQLSRIGGGKFQVAVLNSRGCARSKITTRSLFTAFH
FT                   TGDTREFLQRVRNHHPNKKIYAVGFSFGATMLANYLGEEGENTPLSAACTLSNPWDMVM
FT                   SSVKTSNDWWSKNLFSANITQFLVRLVKVNMGELEVPEGTEPDHPPTVKNPSYYNFTKS
FT                   NLQKAFKFKTIADFDSTYTAPCLGFKSAMDYYKSASSINRLPNIKIPLLSINARDDPVV
FT                   GPEGVPFDLMKQNPHVVHCETDIGGHLAYLDLEWKPWVTKEIAQYFNVFDDHVE"
     MSVNTWPLIN PFNWGYNGTI KHVTHDEGTV KLQLKNGEEP LQFEEFLNKY VPELKNDAKF        60
     KLNPALFTGI LQTMYLGSAD YSREFQVFYG REIVKFSDGG VCTVDYVMKD WENEYKLNET       120
     TKKFDVEKFK QDEADTHAEG WPRLQPRTRY LRDNELQEVH SDDRPLVLVL HGLAGGSHEP       180
     VIRSLTQQLS RIGGGKFQVA VLNSRGCARS KITTRSLFTA FHTGDTREFL QRVRNHHPNK       240
     KIYAVGFSFG ATMLANYLGE EGENTPLSAA CTLSNPWDMV MSSVKTSNDW WSKNLFSANI       300
     TQFLVRLVKV NMGELEVPEG TEPDHPPTVK NPSYYNFTKS NLQKAFKFKT IADFDSTYTA       360
     PCLGFKSAMD YYKSASSINR LPNIKIPLLS INARDDPVVG PEGVPFDLMK QNPHVVHCET       420
     DIGGHLAYLD LEWKPWVTKE IAQYFNVFDD HVE                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page