(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE274

CAGLA1_12.PE274      Location/Qualifiers
FT   CDS             join(complement(655501..655506),complement(654006..654710))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000190952" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438971"
FT                   /gene_name="RPS6B"
FT                   /locus_tag="CAGL0M06303g"
FT                   /product="40S ribosomal protein S6 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG62597.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG022722"
FT                   /db_xref="HOGENOM:HBG316337"
FT                   /db_xref="InterPro:IPR001377"
FT                   /db_xref="InterPro:IPR014401"
FT                   /db_xref="InterPro:IPR018282"
FT                   /db_xref="UniParc:UPI00003B66F9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJH3"
FT                   /transl_table=1
FT                   /translation="MKLNIAYPVNGTQKTVEVDDEHRVRVFYDKRIGQEIEGEAVGDEF
FT                   KGYTFKITGGNDKQGFPMKQGVLLPTRVKLLLAKGHSCYRPRRSGERKRKSVRGAIVGP
FT                   DLAVLSLVIVKKGEQELEGVTDATVPKRLGPKRANHIRKFFGLTKEDDVRDFVIRREVT
FT                   KGEKTYTKAPKIQRLVTPQRLQRKRYQRNLKVRNAQAQREAAAEYAQLLAKRLAERKAE
FT                   KAETRKRRASSLKA"
     MKLNIAYPVN GTQKTVEVDD EHRVRVFYDK RIGQEIEGEA VGDEFKGYTF KITGGNDKQG        60
     FPMKQGVLLP TRVKLLLAKG HSCYRPRRSG ERKRKSVRGA IVGPDLAVLS LVIVKKGEQE       120
     LEGVTDATVP KRLGPKRANH IRKFFGLTKE DDVRDFVIRR EVTKGEKTYT KAPKIQRLVT       180
     PQRLQRKRYQ RNLKVRNAQA QREAAAEYAQ LLAKRLAERK AEKAETRKRR ASSLKA           236
//

If you have problems or comments...

PBIL Back to PBIL home page