(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE278

CAGLA1_12.PE278      Location/Qualifiers
FT   CDS             complement(663660..664514)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066059" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044871"
FT                   /locus_tag="CAGL0M06391g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62601.1"
FT                   /db_xref="HOGENOM:HBG059996"
FT                   /db_xref="HOGENOM:HBG204191"
FT                   /db_xref="InterPro:IPR012483"
FT                   /db_xref="UniParc:UPI00003B70F1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJG9"
FT                   /transl_table=1
FT                   /translation="MIVGYRGVVVRRVGVSRLANVYNTRLFSSGVKLLDEAEQKQDTKK
FT                   IQDFNPRHLGVASELYVPASLSRLPSVITSPKLWFDNVIRRIYMLGLNTVQIGIFRFQT
FT                   GIKPAFLLWKNKAIETYVQVNANFASKSVEKLKPEVSVWVEEALNARSKQIPDNVKLDW
FT                   QLLKFNDVPKLISIQPMMIPGRPLEHIQLLYRFNTKQRLVKLNKTNNKVEKLDRDVVDY
FT                   MVFLCDATTNDLILMGSVFESKPDAKLPKNYDDNTEKAVRRMKECGDIYRVPSSSENPQ
FT                   ITN"
     MIVGYRGVVV RRVGVSRLAN VYNTRLFSSG VKLLDEAEQK QDTKKIQDFN PRHLGVASEL        60
     YVPASLSRLP SVITSPKLWF DNVIRRIYML GLNTVQIGIF RFQTGIKPAF LLWKNKAIET       120
     YVQVNANFAS KSVEKLKPEV SVWVEEALNA RSKQIPDNVK LDWQLLKFND VPKLISIQPM       180
     MIPGRPLEHI QLLYRFNTKQ RLVKLNKTNN KVEKLDRDVV DYMVFLCDAT TNDLILMGSV       240
     FESKPDAKLP KNYDDNTEKA VRRMKECGDI YRVPSSSENP QITN                        284
//

If you have problems or comments...

PBIL Back to PBIL home page