(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE279

CAGLA1_12.PE279      Location/Qualifiers
FT   CDS             664851..667517
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000095264" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438973"
FT                   /gene_name="BRO1"
FT                   /locus_tag="CAGL0M06413g"
FT                   /product="Vacuolar protein-sorting protein BRO1 "
FT                   /biological_process="protein transport"
FT                   /cellular_component="endosome"
FT                   /protein_id="CAG62602.1"
FT                   /db_xref="GO:0005768"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG059997"
FT                   /db_xref="HOGENOM:HBG203904"
FT                   /db_xref="InterPro:IPR004328"
FT                   /db_xref="UniParc:UPI00003B70F2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJG8"
FT                   /transl_table=1
FT                   /translation="MKPSVIGLKCKDTDKVDWKRGLSSYLKRIYGSRQWKEFYDEQLCV
FT                   EMDHVRNNANGELGAVTLVEQNYKYYAYLEQLYLRLGNNIGQFKLEFTWYDAEYGLVSS
FT                   PTKHTQKTLVFEKSCTLYNLGVALTEVANEKINEDFKTAMVHMAKAMECFRYLSENFFN
FT                   SPSADLQTENTKFLSDLSHAEAQEMFLINAINNGTSEKQASLISKLAYSGSNLYENCWE
FT                   FLRTEEGGLTPYGEARWNSIVSGKHHFFRSLAAYYNALALEQNNKYGEAIAFLKLATQC
FT                   LSSSLPYKYALNDNFDFDGFGETIKDKTKQLIKDNDYIFHDSIPQSVSLSSIKALDAIK
FT                   APKWEEQLKPFMEAIAHKCEKLYRGIVPMEVFEKESIYSEKKASMLRQCINDSETADME
FT                   YSSFIEFTHLPNLLSDLKRRYKSQNFSGTTDPQGDMMRDQIQSWIKSISQSKYKDPDEQ
FT                   LKLISSKKQEILTLLAGLPSEQKENVVKLKMALVEAAASDEKLFSLVQPYAAQLRLLKQ
FT                   PDELWKIFNMFSIDESNKQSLLDIDDSKNQEILAKISDIEQMAEDLRLLKEERGRTLKE
FT                   LKSQTNDDDITNTLLVNSKAESEELEVIFKKELDKFKPLTTRIEATIFKQESVVNEVKN
FT                   ELDNVFSLSGLENKTSEEEEKQKKRKEFFMQIEEAATKFLIFNNDLPKGLEFYDSLLKM
FT                   SKDLAVSVKVQNNASGSDNNSNNGYVSGNVIPPSLPPQPRNVGSSIDSQFQSMNLGSVP
FT                   TPQRFPQPPAPNSRPIVSMENYTSQFSVPPAHGDLPPAYNQVPLVPTRNYDQPHGSGNY
FT                   PGNVSSQHPVSSSPIPGAYDQVPMVPPKQPPAEGRSQISRQEQMEREERELQRDPTAFY
FT                   KKSSVFDESLYSRYSGK"
     MKPSVIGLKC KDTDKVDWKR GLSSYLKRIY GSRQWKEFYD EQLCVEMDHV RNNANGELGA        60
     VTLVEQNYKY YAYLEQLYLR LGNNIGQFKL EFTWYDAEYG LVSSPTKHTQ KTLVFEKSCT       120
     LYNLGVALTE VANEKINEDF KTAMVHMAKA MECFRYLSEN FFNSPSADLQ TENTKFLSDL       180
     SHAEAQEMFL INAINNGTSE KQASLISKLA YSGSNLYENC WEFLRTEEGG LTPYGEARWN       240
     SIVSGKHHFF RSLAAYYNAL ALEQNNKYGE AIAFLKLATQ CLSSSLPYKY ALNDNFDFDG       300
     FGETIKDKTK QLIKDNDYIF HDSIPQSVSL SSIKALDAIK APKWEEQLKP FMEAIAHKCE       360
     KLYRGIVPME VFEKESIYSE KKASMLRQCI NDSETADMEY SSFIEFTHLP NLLSDLKRRY       420
     KSQNFSGTTD PQGDMMRDQI QSWIKSISQS KYKDPDEQLK LISSKKQEIL TLLAGLPSEQ       480
     KENVVKLKMA LVEAAASDEK LFSLVQPYAA QLRLLKQPDE LWKIFNMFSI DESNKQSLLD       540
     IDDSKNQEIL AKISDIEQMA EDLRLLKEER GRTLKELKSQ TNDDDITNTL LVNSKAESEE       600
     LEVIFKKELD KFKPLTTRIE ATIFKQESVV NEVKNELDNV FSLSGLENKT SEEEEKQKKR       660
     KEFFMQIEEA ATKFLIFNND LPKGLEFYDS LLKMSKDLAV SVKVQNNASG SDNNSNNGYV       720
     SGNVIPPSLP PQPRNVGSSI DSQFQSMNLG SVPTPQRFPQ PPAPNSRPIV SMENYTSQFS       780
     VPPAHGDLPP AYNQVPLVPT RNYDQPHGSG NYPGNVSSQH PVSSSPIPGA YDQVPMVPPK       840
     QPPAEGRSQI SRQEQMEREE RELQRDPTAF YKKSSVFDES LYSRYSGK                    888
//

If you have problems or comments...

PBIL Back to PBIL home page