(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE284

CAGLA1_12.PE284      Location/Qualifiers
FT   CDS             join(675227..675237,676008..676479)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194513" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501419"
FT                   /locus_tag="CAGL0M06523g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG62607.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG008055"
FT                   /db_xref="HOGENOM:HBG497499"
FT                   /db_xref="InterPro:IPR001147"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018259"
FT                   /db_xref="UniParc:UPI00003B70F7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJG3"
FT                   /transl_table=1
FT                   /translation="MGKSHGYRSRTRYMFQRDFRKHGAIALSTYLKVYKVGDIVDIKAN
FT                   GSIQKGMPHKFYQGKTGVVYNVTKSSVGVIVNKMVGNRYLEKRLNLRVEHVKHSKCRQE
FT                   FLDRVKSNAAKRAEAKAQGKAVQLKRQPAQPREARVVSTEGNVPQTLAPVAYETFI"
     MGKSHGYRSR TRYMFQRDFR KHGAIALSTY LKVYKVGDIV DIKANGSIQK GMPHKFYQGK        60
     TGVVYNVTKS SVGVIVNKMV GNRYLEKRLN LRVEHVKHSK CRQEFLDRVK SNAAKRAEAK       120
     AQGKAVQLKR QPAQPREARV VSTEGNVPQT LAPVAYETFI                             160
//

If you have problems or comments...

PBIL Back to PBIL home page