(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE285

CAGLA1_12.PE285      Location/Qualifiers
FT   CDS             677238..679001
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000154429" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196072"
FT                   /gene_name="SSH4"
FT                   /locus_tag="CAGL0M06545g"
FT                   /product="Protein SSH4"
FT                   /biological_process="protein transport"
FT                   /cellular_component="endosome membrane"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="CAG62608.1"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="GO:0010008"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG202416"
FT                   /db_xref="HOGENOM:HBG252595"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="UniParc:UPI00003B70F8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJG2"
FT                   /transl_table=1
FT                   /translation="MPLIPDSIQSIGVFHVDDPFNPMPDPGDADPETVAFAFFIGIAVV
FT                   FSLLLITLVCTAAYLVCTSSYEGEYDEELANNGDGSRRGILNFRPLFGKKNSNGLLLDS
FT                   NFTNPGEFDDNEEFIEREREALIKMSPFEVDSYMRAKEFQIVSPPAVQEFGTYLDSKDL
FT                   QMIKDRGIQSYYFIPSINDNVDKSGHFLPSFLVQDKLEVEFTRWNKSSSAVLNYPLPYN
FT                   KKDAVYFEVKVYNHKPNSNSIFSIGLVTVPYPYFRIPGMCKFSIAYESTGKLRINDPFF
FT                   PSTLLPKLVEGDVVGFGYRFKTGTIFITHNGKKLMDVTQNVSVELFIALGAMNASYTRT
FT                   YTKDGLLEDPDNIELRNALAEGRELKLSKDIQNPHNPMDETKWDIIDSDEIELHVNLGQ
FT                   TGFVFIEANVKKYGFGSVFGEIGIPPAYNPNDIQKDKLIQKGEELPPQYPEDTENFGLF
FT                   GNLKIKSHIKNPLKEVSSNPSAPELIQKKLKTPIVKTPKVGIYEFTTPIDRKRETNMQP
FT                   SINPPVYEINDTRQSSPEITNETISNEETVSSSSKAEPALQHGQSNKTPNKRQNKKTKQ
FT                   RKNKKKGKKNK"
     MPLIPDSIQS IGVFHVDDPF NPMPDPGDAD PETVAFAFFI GIAVVFSLLL ITLVCTAAYL        60
     VCTSSYEGEY DEELANNGDG SRRGILNFRP LFGKKNSNGL LLDSNFTNPG EFDDNEEFIE       120
     REREALIKMS PFEVDSYMRA KEFQIVSPPA VQEFGTYLDS KDLQMIKDRG IQSYYFIPSI       180
     NDNVDKSGHF LPSFLVQDKL EVEFTRWNKS SSAVLNYPLP YNKKDAVYFE VKVYNHKPNS       240
     NSIFSIGLVT VPYPYFRIPG MCKFSIAYES TGKLRINDPF FPSTLLPKLV EGDVVGFGYR       300
     FKTGTIFITH NGKKLMDVTQ NVSVELFIAL GAMNASYTRT YTKDGLLEDP DNIELRNALA       360
     EGRELKLSKD IQNPHNPMDE TKWDIIDSDE IELHVNLGQT GFVFIEANVK KYGFGSVFGE       420
     IGIPPAYNPN DIQKDKLIQK GEELPPQYPE DTENFGLFGN LKIKSHIKNP LKEVSSNPSA       480
     PELIQKKLKT PIVKTPKVGI YEFTTPIDRK RETNMQPSIN PPVYEINDTR QSSPEITNET       540
     ISNEETVSSS SKAEPALQHG QSNKTPNKRQ NKKTKQRKNK KKGKKNK                     587
//

If you have problems or comments...

PBIL Back to PBIL home page