(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE287

CAGLA1_12.PE287      Location/Qualifiers
FT   CDS             680678..681355
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001030" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438978"
FT                   /locus_tag="CAGL0M06589g"
FT                   /product="Similar to uniprot|Q12084 Saccharomyces
FT                   cerevisiae YDR020c"
FT                   /function="ATP binding"
FT                   /function="kinase activity"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /protein_id="CAG62610.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG203124"
FT                   /db_xref="HOGENOM:HBG465606"
FT                   /db_xref="InterPro:IPR000764"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="UniParc:UPI00003B70FA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJG0"
FT                   /transl_table=1
FT                   /translation="MDKRILLLIGGGHDTGVKSMSNELKTKFDSLFPESNIKVIDIDYE
FT                   QEYMISPARIKRSYSNEDYDFDVLYNTLTHQSEHKAEGEVDIIIVCGCYALYNQKINEL
FT                   ANLRVFVESDGDVRLINKIRSENIDNSEQLATTLQEYLQNLRPEMENYIEPTRVHAHLI
FT                   IPYANKDSGVAIIVDGMVKIVNEVSNSRSPDRQNSKEIARNQLYDFLGESMDNERSRYY
FT                   DLA"
     MDKRILLLIG GGHDTGVKSM SNELKTKFDS LFPESNIKVI DIDYEQEYMI SPARIKRSYS        60
     NEDYDFDVLY NTLTHQSEHK AEGEVDIIIV CGCYALYNQK INELANLRVF VESDGDVRLI       120
     NKIRSENIDN SEQLATTLQE YLQNLRPEME NYIEPTRVHA HLIIPYANKD SGVAIIVDGM       180
     VKIVNEVSNS RSPDRQNSKE IARNQLYDFL GESMDNERSR YYDLA                       225
//

If you have problems or comments...

PBIL Back to PBIL home page