(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE292

CAGLA1_12.PE292      Location/Qualifiers
FT   CDS             complement(686466..687554)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141851" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438981"
FT                   /locus_tag="CAGL0M06699g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62615.1"
FT                   /db_xref="HOGENOM:HBG058585"
FT                   /db_xref="HOGENOM:HBG203057"
FT                   /db_xref="InterPro:IPR013907"
FT                   /db_xref="UniParc:UPI00003B70FD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJF5"
FT                   /transl_table=1
FT                   /translation="MEEMEVQKRLTSKDVPRKDKRRVNLENRVGKIQQSFILERDSYYR
FT                   DRLTSLQTDLTSLHQGNNELFMRKLRDLEEARDLELVRLRLYEEYRVYRSGIEFQEEIE
FT                   KTKEDHERLVKICKERLYQNIEMKTKKLQEERLLMDVANIHTYSMDYDRPHYQKNTRSH
FT                   TASGWESSSNDFGRDTANESATDTGLSGFGNERRSLRRRVVLGREGSGLEGGNGGNATS
FT                   GYTSGGINGDGYNYGKSYNTEDSDGGRYGANPYASPSGRGSQRQNNSGGYRTDMNSDTE
FT                   FLQSIGDSSELYNLLFGDKNVGGKDGNKSSSDKKKPRGTQRYSMKTAPPLQSLKTEEVS
FT                   EDIALIRELTGQPPAPFKVDKQ"
     MEEMEVQKRL TSKDVPRKDK RRVNLENRVG KIQQSFILER DSYYRDRLTS LQTDLTSLHQ        60
     GNNELFMRKL RDLEEARDLE LVRLRLYEEY RVYRSGIEFQ EEIEKTKEDH ERLVKICKER       120
     LYQNIEMKTK KLQEERLLMD VANIHTYSMD YDRPHYQKNT RSHTASGWES SSNDFGRDTA       180
     NESATDTGLS GFGNERRSLR RRVVLGREGS GLEGGNGGNA TSGYTSGGIN GDGYNYGKSY       240
     NTEDSDGGRY GANPYASPSG RGSQRQNNSG GYRTDMNSDT EFLQSIGDSS ELYNLLFGDK       300
     NVGGKDGNKS SSDKKKPRGT QRYSMKTAPP LQSLKTEEVS EDIALIRELT GQPPAPFKVD       360
     KQ                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page