(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE294

CAGLA1_12.PE294      Location/Qualifiers
FT   CDS             690036..690878
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000188365" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044872"
FT                   /locus_tag="CAGL0M06765g"
FT                   /product="Similar to uniprot|P53965 Saccharomyces
FT                   cerevisiae YNL032w SIW14"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /protein_id="CAG62617.1"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="HOGENOM:HBG202707"
FT                   /db_xref="HOGENOM:HBG253090"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020428"
FT                   /db_xref="UniParc:UPI00003B70FF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJF3"
FT                   /transl_table=1
FT                   /translation="MSPGSGEESPLRDIVRSTSSLKIDDLIKNESDIIRILNQQEDLLM
FT                   DNGRVRNVHHLVDEDNLLREEFDKVLKQFHGNEDNELKIKGNEEDIDDLFDEEEHKKSS
FT                   TGLLLSCDSEVTPPENFSHVVGEIYRSSFPRTENFAFLQKRLKLKSILVLIPEEYPQEN
FT                   LDFMEKANIKLFQVGMSGNKEPFVNIPSDLLTKALEVVLNPENQPILIHCNRGKHRTGC
FT                   LIGCIRKLQSWSLTMIFDEYRRFAFPKARALDQQFIEMYDDDKIKSIATQNKWLPLQW"
     MSPGSGEESP LRDIVRSTSS LKIDDLIKNE SDIIRILNQQ EDLLMDNGRV RNVHHLVDED        60
     NLLREEFDKV LKQFHGNEDN ELKIKGNEED IDDLFDEEEH KKSSTGLLLS CDSEVTPPEN       120
     FSHVVGEIYR SSFPRTENFA FLQKRLKLKS ILVLIPEEYP QENLDFMEKA NIKLFQVGMS       180
     GNKEPFVNIP SDLLTKALEV VLNPENQPIL IHCNRGKHRT GCLIGCIRKL QSWSLTMIFD       240
     EYRRFAFPKA RALDQQFIEM YDDDKIKSIA TQNKWLPLQW                             280
//

If you have problems or comments...

PBIL Back to PBIL home page