(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE295

CAGLA1_12.PE295      Location/Qualifiers
FT   CDS             complement(691398..692996)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196074"
FT                   /locus_tag="CAGL0M06787g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="glycolipid 2-alpha-mannosyltransferase activity "
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62618.1"
FT                   /db_xref="GO:0004377"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG192431"
FT                   /db_xref="HOGENOM:HBG396033"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="UniParc:UPI00003B7100"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJF2"
FT                   /transl_table=1
FT                   /translation="MRVKVKRWVNDAVEEVLDWLLSTIAIYMYITAIICGTFLYFTYPS
FT                   RTDIRFYSEQDLGTERDAPFYYGCVNTEGYLQAPEYKKMNAAFVMLTRNNELKDVLSSM
FT                   NSIEAHFNQWFKYPYVFLNDEPFSEEFKKSIREATDADIEFGTLDESQWEFPEEVRNTF
FT                   EYQNAITDQGDRGILYGNMESYHKMCRFYSGIFYKHPLMQKYEWYWRLEPDVEFFCDLT
FT                   YDPFFEMHRRNKKYAFTMIIPEIYWTVPNLFRYTKAFIREYGVKVGTLWKLFATNYDIL
FT                   KTDKGRDEFTDYENMVRDDLHQWVKFGGDVEPKLSEKVAIDHLLESETADDDVGLMFLV
FT                   NRARSKVPLIEDEFEGEEYNLCHFWSNFEIARLDVFDNEVYNSYFQYLEASGGFWKERW
FT                   GDAPVHSIGLALTLDVDDIHYFRDIGYMHSILKHCPKNSPDLNEFQYKPANKKYKRSSW
FT                   TRYDTPIEGGSGCRCRCPSKPAEVEDTITFCFEKWMDVTHLKKGEVELYQLFNIEEKEE
FT                   MVRNDFERHHQQQNQ"
     MRVKVKRWVN DAVEEVLDWL LSTIAIYMYI TAIICGTFLY FTYPSRTDIR FYSEQDLGTE        60
     RDAPFYYGCV NTEGYLQAPE YKKMNAAFVM LTRNNELKDV LSSMNSIEAH FNQWFKYPYV       120
     FLNDEPFSEE FKKSIREATD ADIEFGTLDE SQWEFPEEVR NTFEYQNAIT DQGDRGILYG       180
     NMESYHKMCR FYSGIFYKHP LMQKYEWYWR LEPDVEFFCD LTYDPFFEMH RRNKKYAFTM       240
     IIPEIYWTVP NLFRYTKAFI REYGVKVGTL WKLFATNYDI LKTDKGRDEF TDYENMVRDD       300
     LHQWVKFGGD VEPKLSEKVA IDHLLESETA DDDVGLMFLV NRARSKVPLI EDEFEGEEYN       360
     LCHFWSNFEI ARLDVFDNEV YNSYFQYLEA SGGFWKERWG DAPVHSIGLA LTLDVDDIHY       420
     FRDIGYMHSI LKHCPKNSPD LNEFQYKPAN KKYKRSSWTR YDTPIEGGSG CRCRCPSKPA       480
     EVEDTITFCF EKWMDVTHLK KGEVELYQLF NIEEKEEMVR NDFERHHQQQ NQ               532
//

If you have problems or comments...

PBIL Back to PBIL home page