(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE299

CAGLA1_12.PE299      Location/Qualifiers
FT   CDS             complement(699260..700279)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217621" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349249"
FT                   /gene_name="SSN8"
FT                   /locus_tag="CAGL0M06875g"
FT                   /product="RNA polymerase II holoenzyme cyclin-like subunit "
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62622.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG396776"
FT                   /db_xref="HOGENOM:HBG436057"
FT                   /db_xref="HSSP:1ZP2"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR015429"
FT                   /db_xref="UniParc:UPI00003B7104"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJE8"
FT                   /transl_table=1
FT                   /translation="MSGSYWTSMQRQKWQHTKPSLARERQRLWVMECQLFPQGLNIIVD
FT                   SKPNSADSSNGNAANNGGGNGRSQLVATTKNIPITHRDLHYDKDYNLRIYCYFLIMKLG
FT                   RRLNIRQYALATAHIYLSRFLLKASVREVNLYLLVTTCVYLACKVEECPQYIRTLVSEA
FT                   RSLWPEFIPPDPTKVTEFEFYLIEELQCYLIVHHPYKSMEQIVEALKEEPFKLTFTSDE
FT                   LQNCWSLINDSFINDVHLTYAPHIIAMACLFITVSIQGSNTKELSLTSAVTETLTSQSS
FT                   LTPQQQTFFRFLAESHVDLEEVMDTIQQQIILYDHWDRYHEPWIKYLLHTLYLRPLSA"
     MSGSYWTSMQ RQKWQHTKPS LARERQRLWV MECQLFPQGL NIIVDSKPNS ADSSNGNAAN        60
     NGGGNGRSQL VATTKNIPIT HRDLHYDKDY NLRIYCYFLI MKLGRRLNIR QYALATAHIY       120
     LSRFLLKASV REVNLYLLVT TCVYLACKVE ECPQYIRTLV SEARSLWPEF IPPDPTKVTE       180
     FEFYLIEELQ CYLIVHHPYK SMEQIVEALK EEPFKLTFTS DELQNCWSLI NDSFINDVHL       240
     TYAPHIIAMA CLFITVSIQG SNTKELSLTS AVTETLTSQS SLTPQQQTFF RFLAESHVDL       300
     EEVMDTIQQQ IILYDHWDRY HEPWIKYLLH TLYLRPLSA                              339
//

If you have problems or comments...

PBIL Back to PBIL home page