(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE3

CAGLA1_12.PE3        Location/Qualifiers
FT   CDS             complement(24106..25221)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000276704" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348448"
FT                   /locus_tag="CAGL0M00176g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="branched-chain-amino-acid transaminase activity "
FT                   /biological_process="branched chain family amino acid
FT                   metabolic process"
FT                   /protein_id="CAG62328.1"
FT                   /db_xref="GO:0004084"
FT                   /db_xref="GO:0009081"
FT                   /db_xref="HOGENOM:HBG424074"
FT                   /db_xref="HOGENOM:HBG617123"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="UniParc:UPI00003B6FE3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK92"
FT                   /transl_table=1
FT                   /translation="MDASRLKITKVSTPSERKPNDQLVFGKTFTDHMLTIEWTSENGWD
FT                   APEIKPYGKLCLDPSSIVFHYAFELFEGMKAYRTKDGKIAMFRPEKNMERMNKSAARIC
FT                   LPTFDGEELIKLIGKLIELDKHLIPEGEGYSLYIRPTLIGTSEGLGVKEPDRALLFVIC
FT                   SPVGPYYKTGFKAVRLDATDYATRAWPGGVGDKKLGANYAPCVLPQTQAAAKGFQQNLW
FT                   LFGPEHYVTEVGTMNAFFAFNCKETGKKELVTAPLDGTILEGVTRDSILTLARKYLDPN
FT                   EWEINERYFTIHEVQEKAHKGELLEAFGSGTAAIVSPIKEIGWKDTIINVPLIPGEQSG
FT                   PLTKQIASWMMDIQYGKVELDNWLRIVADIN"
     MDASRLKITK VSTPSERKPN DQLVFGKTFT DHMLTIEWTS ENGWDAPEIK PYGKLCLDPS        60
     SIVFHYAFEL FEGMKAYRTK DGKIAMFRPE KNMERMNKSA ARICLPTFDG EELIKLIGKL       120
     IELDKHLIPE GEGYSLYIRP TLIGTSEGLG VKEPDRALLF VICSPVGPYY KTGFKAVRLD       180
     ATDYATRAWP GGVGDKKLGA NYAPCVLPQT QAAAKGFQQN LWLFGPEHYV TEVGTMNAFF       240
     AFNCKETGKK ELVTAPLDGT ILEGVTRDSI LTLARKYLDP NEWEINERYF TIHEVQEKAH       300
     KGELLEAFGS GTAAIVSPIK EIGWKDTIIN VPLIPGEQSG PLTKQIASWM MDIQYGKVEL       360
     DNWLRIVADI N                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page