(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE30

CAGLA1_12.PE30       Location/Qualifiers
FT   CDS             86290..89556
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348719"
FT                   /locus_tag="CAGL0M00770g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="DNA binding"
FT                   /protein_id="CAG62355.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="HOGENOM:HBG124085"
FT                   /db_xref="InterPro:IPR001025"
FT                   /db_xref="UniParc:UPI00003B6FFE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK65"
FT                   /transl_table=1
FT                   /translation="MAELIKDLEGWQIIIKDQDGNVMDERDRKVRRKRNVSTDLFIFRE
FT                   KDALTFGRGQNVVVHDEVSDSYAVYLIHEIRQNTLNHALEILCFTYLRWFELEPRDYYK
FT                   EFKPEYLSMTNQQITEKFLEEIDRDEIYLTAEITPIWLKDFIDIAEVYNAKKWAQVRQS
FT                   VNKERNFLVRYVCEPVAENFVPVDIDNIMDQMRKRSARDFETMLKNLTVNGFVHSSSKK
FT                   RQKIKAEDTDNTVTKKNLLHNQKQKEPESHELKYQKVQLEDSPQPHHKKPQSRIDDHYS
FT                   VVSDMPHGRIVNTGVKPTTKKSSTSSQTQTDHTQKRKLQSDGGKSGPSNMKSTVGNGSS
FT                   NDNIQKKRKTEDSSKTPSNLHTTMTGVSRSTGVTSDAGKVVDKEIIKNPTSVPSQGGNR
FT                   TKGNDMSKKEPYSKAIAAANQLKAGRTNQKSNQTAKKPSTTSSNEREEKIPAYLSGRFQ
FT                   PSEVIDSVQSGTLNDLMTQVRKRGGVSEALKYKAKNHVDGTGQDLYATAKSFTSNLRRT
FT                   LLGSENSAQSQQQNASDIEKRKPYNVIDDFKNNSSAKILEHVKRGNTVSELLCHQPIDK
FT                   TPEKSNDEKLKPLLTALSDLTTNKQFVQLRNIVGLTAQSKNSGSIFEKLRKCTTSESLI
FT                   QCMSDSITSDIILSMRNKEFVTIYGSLFNAIINGRNKSLYLTGDDEYTIKYVFNKVAHE
FT                   LLLSATFEEIPQFKLASVPSSYDNFYQGLWQNISGDILSDTEAAIALDSYFSVMQPVQR
FT                   FPILIYIENMDEFFNNSETIYKDLINWFLNPLSKITLICNGTVVNNEIGNPLKDIFLHV
FT                   NFPSVSEEQDCSVANISKVINQINSSYFYFNADLQAATFCEFYKHYTKNWQKINFRINE
FT                   PEVGISVKNIQNALTLKGFDSIINVHKHIYQCLRNVVNRYIDSTAKKTTVDIQANQLSV
FT                   SAGSANTHYDLMEPLYGRIMSSLAELTFVDKLVLFCTVLCRLRKSSVEKIDLNEVYNVI
FT                   VDVLHHNCDNSPMISNLLLTYSTIKNRNDKGSAIKLFLSSLMWLDVFTRLYRTGFVTLH
FT                   VDQEDRNQIKVALAGFEVDSILAELKRDSSMSWIQSCLTE"
     MAELIKDLEG WQIIIKDQDG NVMDERDRKV RRKRNVSTDL FIFREKDALT FGRGQNVVVH        60
     DEVSDSYAVY LIHEIRQNTL NHALEILCFT YLRWFELEPR DYYKEFKPEY LSMTNQQITE       120
     KFLEEIDRDE IYLTAEITPI WLKDFIDIAE VYNAKKWAQV RQSVNKERNF LVRYVCEPVA       180
     ENFVPVDIDN IMDQMRKRSA RDFETMLKNL TVNGFVHSSS KKRQKIKAED TDNTVTKKNL       240
     LHNQKQKEPE SHELKYQKVQ LEDSPQPHHK KPQSRIDDHY SVVSDMPHGR IVNTGVKPTT       300
     KKSSTSSQTQ TDHTQKRKLQ SDGGKSGPSN MKSTVGNGSS NDNIQKKRKT EDSSKTPSNL       360
     HTTMTGVSRS TGVTSDAGKV VDKEIIKNPT SVPSQGGNRT KGNDMSKKEP YSKAIAAANQ       420
     LKAGRTNQKS NQTAKKPSTT SSNEREEKIP AYLSGRFQPS EVIDSVQSGT LNDLMTQVRK       480
     RGGVSEALKY KAKNHVDGTG QDLYATAKSF TSNLRRTLLG SENSAQSQQQ NASDIEKRKP       540
     YNVIDDFKNN SSAKILEHVK RGNTVSELLC HQPIDKTPEK SNDEKLKPLL TALSDLTTNK       600
     QFVQLRNIVG LTAQSKNSGS IFEKLRKCTT SESLIQCMSD SITSDIILSM RNKEFVTIYG       660
     SLFNAIINGR NKSLYLTGDD EYTIKYVFNK VAHELLLSAT FEEIPQFKLA SVPSSYDNFY       720
     QGLWQNISGD ILSDTEAAIA LDSYFSVMQP VQRFPILIYI ENMDEFFNNS ETIYKDLINW       780
     FLNPLSKITL ICNGTVVNNE IGNPLKDIFL HVNFPSVSEE QDCSVANISK VINQINSSYF       840
     YFNADLQAAT FCEFYKHYTK NWQKINFRIN EPEVGISVKN IQNALTLKGF DSIINVHKHI       900
     YQCLRNVVNR YIDSTAKKTT VDIQANQLSV SAGSANTHYD LMEPLYGRIM SSLAELTFVD       960
     KLVLFCTVLC RLRKSSVEKI DLNEVYNVIV DVLHHNCDNS PMISNLLLTY STIKNRNDKG      1020
     SAIKLFLSSL MWLDVFTRLY RTGFVTLHVD QEDRNQIKVA LAGFEVDSIL AELKRDSSMS      1080
     WIQSCLTE                                                               1088
//

If you have problems or comments...

PBIL Back to PBIL home page