(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE301

CAGLA1_12.PE301      Location/Qualifiers
FT   CDS             complement(703702..706572)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112499" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438985"
FT                   /locus_tag="CAGL0M06919g"
FT                   /product="Similar to uniprot|P53971 Saccharomyces
FT                   cerevisiae YNL023c FAP1"
FT                   /function="nucleic acid binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62624.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG190560"
FT                   /db_xref="HOGENOM:HBG397891"
FT                   /db_xref="InterPro:IPR000967"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="UniParc:UPI00003B7106"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJE6"
FT                   /transl_table=1
FT                   /translation="MQDGRTEVTQDEYRHYDDHPDNSSLVIGLSEDESEIETNMGAELS
FT                   EELSDLDEGDEKDMAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYEC
FT                   IREWAEKSTSKRTDKLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTC
FT                   NAKICSHGCSQICHLGPHQECTRMMSIKCSCGKVTKDIVCFQRRLYSKGFNCETVCDKL
FT                   LPCGIHKCNRKCHTGLCGSCPETIISKNTNMKIRCYCGQTSKDKIKCKDVRFPANAAYS
FT                   KDDKGQRWIGVFMCDKIRKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGK
FT                   NELTDLSKPRSKCTDAIPTCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACE
FT                   QKQFTIPCGFNDHARCNLKCESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADE
FT                   STIEPIHICLKDCNLTLSCGIHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRC
FT                   GTKLPNCPYPCIRVVRGETDCGHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTV
FT                   CFMKDVSCGKVCGERLQTCYHKCQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKF
FT                   EECPDIPCTALVKITCPCGRIEKEVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKE
FT                   AFGIVDKPQNTHNEEMARLEQVISTASTFADLDLPFTEPVITTYIRHENWCTDIENTLN
FT                   KLIDDNNRTSLHFKPMRPPQRYFIRELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKP
FT                   ILSISEAAPLYQSYKKLEKEKKQANFESMTTTRLINFTPEMSPELESAARFNGFLVTNV
FT                   GEFTSTDDLQNLFAPYLKSTLVVEPQFQILPERKQAVIYPNKYKEISINVERDMETLVQ
FT                   HFDFLIKESLLAGGVELCNIENVLAE"
     MQDGRTEVTQ DEYRHYDDHP DNSSLVIGLS EDESEIETNM GAELSEELSD LDEGDEKDMA        60
     YYEKAVQEIV KGDSYSCLIC TVELDYTCKL YACEKCYRVY DYECIREWAE KSTSKRTDKL       120
     WACPNCFYTK KAIPKKNRPT CWCGEQVNPE PNPLNPNSCG QTCNAKICSH GCSQICHLGP       180
     HQECTRMMSI KCSCGKVTKD IVCFQRRLYS KGFNCETVCD KLLPCGIHKC NRKCHTGLCG       240
     SCPETIISKN TNMKIRCYCG QTSKDKIKCK DVRFPANAAY SKDDKGQRWI GVFMCDKIRK       300
     VPYECGEHSF YEKCKAPPSI SGRLICEFSP KKLKTCPCGK NELTDLSKPR SKCTDAIPTC       360
     GQVCGKMLKC GKHKCPFACH LGDCMDPCTQ IEKVRCACEQ KQFTIPCGFN DHARCNLKCE       420
     SLMSCRRHRC TERCCAGRPL AERRRKTMKI NVRDLADEST IEPIHICLKD CNLTLSCGIH       480
     KCNRKCHAGK CPPCLESDSN DLVCPCGKTI VEAPVRCGTK LPNCPYPCIR VVRGETDCGH       540
     SPMPHECHPP DIPCPDCTAT VFKPCKCGKE QRVRTVCFMK DVSCGKVCGE RLQTCYHKCQ       600
     KKCHEPGACQ TVCKQTCNMP RLYCNHRCPK PCHKFEECPD IPCTALVKIT CPCGRIEKEV       660
     TCGVYSKNKE AQDSTRIVCD EECAVLQRHM QLKEAFGIVD KPQNTHNEEM ARLEQVISTA       720
     STFADLDLPF TEPVITTYIR HENWCTDIEN TLNKLIDDNN RTSLHFKPMR PPQRYFIREL       780
     AKAYNLYSES QDPEPNRSVF VKKNLDGSST KPILSISEAA PLYQSYKKLE KEKKQANFES       840
     MTTTRLINFT PEMSPELESA ARFNGFLVTN VGEFTSTDDL QNLFAPYLKS TLVVEPQFQI       900
     LPERKQAVIY PNKYKEISIN VERDMETLVQ HFDFLIKESL LAGGVELCNI ENVLAE           956
//

If you have problems or comments...

PBIL Back to PBIL home page