(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE303

CAGLA1_12.PE303      Location/Qualifiers
FT   CDS             709544..710338
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000256285" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349250"
FT                   /locus_tag="CAGL0M06963g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="6-phosphogluconolactonase activity"
FT                   /biological_process="pentose-phosphate shunt"
FT                   /protein_id="CAG62626.1"
FT                   /db_xref="GO:0006098"
FT                   /db_xref="GO:0017057"
FT                   /db_xref="HOGENOM:HBG398862"
FT                   /db_xref="HOGENOM:HBG725991"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="UniParc:UPI00003B7108"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJE4"
FT                   /transl_table=1
FT                   /translation="MTTAAPKLIQFDDEREVACATTEQIIKSQNSKLRQPVKKRTRREN
FT                   RFRLAISGGQLMQTLLKALLYRKEEIEWEKWDIFFVDERLVPFNSNESNYGQLKRGLLD
FT                   PLKSINYPQPNVYHIEETEIDDANVVAQTYEKQLINIFASRDSVRLPTFDMILLGCAPD
FT                   GHIASLFPQCHHNLREEMAWVIPITDAPLEPTKRISMSVPVISNSNQIIFMVTGSNNAE
FT                   LMKMIIEKPSCELPSALISTCAPGRVSWYVENEALKEVMLLD"
     MTTAAPKLIQ FDDEREVACA TTEQIIKSQN SKLRQPVKKR TRRENRFRLA ISGGQLMQTL        60
     LKALLYRKEE IEWEKWDIFF VDERLVPFNS NESNYGQLKR GLLDPLKSIN YPQPNVYHIE       120
     ETEIDDANVV AQTYEKQLIN IFASRDSVRL PTFDMILLGC APDGHIASLF PQCHHNLREE       180
     MAWVIPITDA PLEPTKRISM SVPVISNSNQ IIFMVTGSNN AELMKMIIEK PSCELPSALI       240
     STCAPGRVSW YVENEALKEV MLLD                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page