(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE313

CAGLA1_12.PE313      Location/Qualifiers
FT   CDS             complement(723774..724271)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000239674" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349253"
FT                   /gene_name="EGD2"
FT                   /locus_tag="CAGL0M07161g"
FT                   /product="Nascent polypeptide-associated complex subunit
FT                   alpha"
FT                   /biological_process="protein transport"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62635.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG236848"
FT                   /db_xref="HOGENOM:HBG628290"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR002715"
FT                   /db_xref="InterPro:IPR016641"
FT                   /db_xref="UniParc:UPI00003B7111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJD5"
FT                   /transl_table=1
FT                   /translation="MAEIPEGANVTILNRNEKKARELISKLGLKKVPGIIRVTFRKKDN
FT                   QIFAIEKPEVFRSVGGNYVVFGEAKVDNFTQRLAAAQQQAQSQTATKTPEDIQADMQAA
FT                   AVANENKTEGDAAEEDVDAGDLSNDDIDLVVQQTNATKGQAIKALKEHNGDIVNAIMSL
FT                   SK"
     MAEIPEGANV TILNRNEKKA RELISKLGLK KVPGIIRVTF RKKDNQIFAI EKPEVFRSVG        60
     GNYVVFGEAK VDNFTQRLAA AQQQAQSQTA TKTPEDIQAD MQAAAVANEN KTEGDAAEED       120
     VDAGDLSNDD IDLVVQQTNA TKGQAIKALK EHNGDIVNAI MSLSK                       165
//

If you have problems or comments...

PBIL Back to PBIL home page