(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE318

CAGLA1_12.PE318      Location/Qualifiers
FT   CDS             731627..732076
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000095211" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438994"
FT                   /locus_tag="CAGL0M07271g"
FT                   /product="Glutaredoxin"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAG62640.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG326260"
FT                   /db_xref="HOGENOM:HBG728471"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="UniParc:UPI00003B7116"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJD0"
FT                   /transl_table=1
FT                   /translation="MFATRLLGKSALLGTTSTRMVFRSQMARYMSTETKKAIEGAIASA
FT                   PVVLFMKGTPEFPQCGFSRATISMLGQQGVDPEKFAAYNVLEDPELREGIKEFSNWPTI
FT                   PQLYVNKEFIGGCDVITSMARSGELADVLEEANALVPEEKEEGTD"
     MFATRLLGKS ALLGTTSTRM VFRSQMARYM STETKKAIEG AIASAPVVLF MKGTPEFPQC        60
     GFSRATISML GQQGVDPEKF AAYNVLEDPE LREGIKEFSN WPTIPQLYVN KEFIGGCDVI       120
     TSMARSGELA DVLEEANALV PEEKEEGTD                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page