(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE32

CAGLA1_12.PE32       Location/Qualifiers
FT   CDS             91268..92035
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000105220" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436692"
FT                   /gene_name="RPS1"
FT                   /locus_tag="CAGL0M00814g"
FT                   /product="40S ribosomal protein S1 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG62357.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG211272"
FT                   /db_xref="HOGENOM:HBG402643"
FT                   /db_xref="InterPro:IPR001593"
FT                   /db_xref="InterPro:IPR018281"
FT                   /db_xref="UniParc:UPI00003B7000"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK63"
FT                   /transl_table=1
FT                   /translation="MAVGKNKRLSKGKKGLKKKVVDPFTRKEWYDIKAPSTFENRNVGK
FT                   TLVNKSTGLKSASDALKGRVVEVCLADLQGSEDHSFRKVKLRVDDVQGKNLLTNFHGMD
FT                   FTADKLRSMVRKWQTLIEANVTVKTSDEYIIRVFAIAFTRKQSNQVKRTAYAQSSHIRA
FT                   IRKVISDILTREVSNSTLAQFTSKLIPEVINKEIENATKDIFPLQNVHIRKVKLLKQPK
FT                   FDLGSLMALHGEGSAEEKGKKVSGFKDEVLETV"
     MAVGKNKRLS KGKKGLKKKV VDPFTRKEWY DIKAPSTFEN RNVGKTLVNK STGLKSASDA        60
     LKGRVVEVCL ADLQGSEDHS FRKVKLRVDD VQGKNLLTNF HGMDFTADKL RSMVRKWQTL       120
     IEANVTVKTS DEYIIRVFAI AFTRKQSNQV KRTAYAQSSH IRAIRKVISD ILTREVSNST       180
     LAQFTSKLIP EVINKEIENA TKDIFPLQNV HIRKVKLLKQ PKFDLGSLMA LHGEGSAEEK       240
     GKKVSGFKDE VLETV                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page