(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE321

CAGLA1_12.PE321      Location/Qualifiers
FT   CDS             complement(743020..743961)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438995"
FT                   /gene_name="LGE1"
FT                   /locus_tag="CAGL0M07337g"
FT                   /product="Transcriptional regulatory protein LGE1 "
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62643.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG124087"
FT                   /db_xref="InterPro:IPR021581"
FT                   /db_xref="UniParc:UPI00003B7119"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJC7"
FT                   /transl_table=1
FT                   /translation="MSDERYQSRYGRYDSGRGGRSGYYSNYQNSSHHRSNDGPNTNTHG
FT                   PSNGNGNSGGYYHGYYNRHGSMNGRAASSGRGYYGGHNTHITSAPHNNPNAYSRAPATG
FT                   NTSYTGSYYSRGGNSSGRGGYSSYNRGGYHASHQYNNGGYYHRNNNYNSSYTERQKSVS
FT                   GDSATSGGMKYTSSHRTTHVTHPAHPPITIQRSGSNGNGVAQGNASSGEVPTAPRRETT
FT                   AQNNGRDKREEQLKKYGISNMAQGYLEIMDQNSSSTTSVTQTEIELDEKLREMNSQVFR
FT                   TMCELALVENQYTRDTLNVQLTQEKLDTLLLS"
     MSDERYQSRY GRYDSGRGGR SGYYSNYQNS SHHRSNDGPN TNTHGPSNGN GNSGGYYHGY        60
     YNRHGSMNGR AASSGRGYYG GHNTHITSAP HNNPNAYSRA PATGNTSYTG SYYSRGGNSS       120
     GRGGYSSYNR GGYHASHQYN NGGYYHRNNN YNSSYTERQK SVSGDSATSG GMKYTSSHRT       180
     THVTHPAHPP ITIQRSGSNG NGVAQGNASS GEVPTAPRRE TTAQNNGRDK REEQLKKYGI       240
     SNMAQGYLEI MDQNSSSTTS VTQTEIELDE KLREMNSQVF RTMCELALVE NQYTRDTLNV       300
     QLTQEKLDTL LLS                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page