(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE323

CAGLA1_12.PE323      Location/Qualifiers
FT   CDS             complement(745077..746510)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349256"
FT                   /locus_tag="CAGL0M07381g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="glycolipid 2-alpha-mannosyltransferase activity "
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62645.1"
FT                   /db_xref="GO:0004377"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG124090"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="UniParc:UPI00003B711B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJC5"
FT                   /transl_table=1
FT                   /translation="METRGLIHWLRYYYKVFHRNRTLKAVAVLLSFVLFIYYVRNSDIT
FT                   DKLVTFAGEENVKSLHAVKANIRANWNQEDDGDKFKKDLSASLQVKLDNILGTQNMSLA
FT                   EMGELPIDAETIEEQKSIRYAKLLKDHKATENSTMGFLFKSLANEGLKPSACIYSFVTG
FT                   NSELRKLLRTIESVQKKFNHKFGYPWVIISPEPLSEKFHADVEKKLEEFTSAIDDVKTE
FT                   VEFGTVPPEHWGFPDFIDSTVASNARIDLFDIPNGDSQLFRLINRYNAGLAAHHTLLKK
FT                   YDWYMRVSPGIRLNCEMEYDIMRWMQDNRKIFGFTLSIKEIERSAKKIWGHNLNFTAHN
FT                   REFYNPIEKSSLRSYIQVGRDTYNYCSFSTDLQIVNLNFLRSPVYTKYFEYMDKAGGIF
FT                   YERWSDSIIQSMAYSTMVPAKMIQHISPMGYQNKETVVCPADDIMWREYKCECDQGSDI
FT                   SFNRDLTCTQRYKDTQGMF"
     METRGLIHWL RYYYKVFHRN RTLKAVAVLL SFVLFIYYVR NSDITDKLVT FAGEENVKSL        60
     HAVKANIRAN WNQEDDGDKF KKDLSASLQV KLDNILGTQN MSLAEMGELP IDAETIEEQK       120
     SIRYAKLLKD HKATENSTMG FLFKSLANEG LKPSACIYSF VTGNSELRKL LRTIESVQKK       180
     FNHKFGYPWV IISPEPLSEK FHADVEKKLE EFTSAIDDVK TEVEFGTVPP EHWGFPDFID       240
     STVASNARID LFDIPNGDSQ LFRLINRYNA GLAAHHTLLK KYDWYMRVSP GIRLNCEMEY       300
     DIMRWMQDNR KIFGFTLSIK EIERSAKKIW GHNLNFTAHN REFYNPIEKS SLRSYIQVGR       360
     DTYNYCSFST DLQIVNLNFL RSPVYTKYFE YMDKAGGIFY ERWSDSIIQS MAYSTMVPAK       420
     MIQHISPMGY QNKETVVCPA DDIMWREYKC ECDQGSDISF NRDLTCTQRY KDTQGMF          477
//

If you have problems or comments...

PBIL Back to PBIL home page