(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE325

CAGLA1_12.PE325      Location/Qualifiers
FT   CDS             complement(748504..749631)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176034" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438996"
FT                   /locus_tag="CAGL0M07425g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="regulation of signal transduction "
FT                   /biological_process="response to biotic stimulus "
FT                   /protein_id="CAG62647.1"
FT                   /db_xref="GO:0009607"
FT                   /db_xref="GO:0009966"
FT                   /db_xref="HOGENOM:HBG270660"
FT                   /db_xref="HOGENOM:HBG324543"
FT                   /db_xref="InterPro:IPR007304"
FT                   /db_xref="UniParc:UPI00003B711D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJC3"
FT                   /transl_table=1
FT                   /translation="MSGTILEQFRGIQGTIDRKLLHTQLRQDSEEYQKLLTGTIQELLD
FT                   LKSKVYHKLSLFSSNETVEDIATSSLLYLSLDYYLGLLCSRKQATSNQLANPMDKNKMR
FT                   IMFLDKAIQLFMQYLSTLQDNEILDESISKKIDGFENTFMPTMDELYAVPKHKEDLSGA
FT                   QLRRQEKIEMHKQNTAVAQQLRILEGKVSEDQENDDDELLRKLYLQKLKLLSYETFDEI
FT                   EKILYEKELLSNFVRMAPQSDNEPHLAGNDQSKSSNDDPTGYTDKLETLNKPLLSKHGK
FT                   VLRNFTLVDKRSELKSKVKGYGQYGPTMSVEEFLEQEWEQGRVLQGGEEPTKEEIEALN
FT                   EDNMEWQDKETYKAREWDEFKEENPKGSGNTMNRG"
     MSGTILEQFR GIQGTIDRKL LHTQLRQDSE EYQKLLTGTI QELLDLKSKV YHKLSLFSSN        60
     ETVEDIATSS LLYLSLDYYL GLLCSRKQAT SNQLANPMDK NKMRIMFLDK AIQLFMQYLS       120
     TLQDNEILDE SISKKIDGFE NTFMPTMDEL YAVPKHKEDL SGAQLRRQEK IEMHKQNTAV       180
     AQQLRILEGK VSEDQENDDD ELLRKLYLQK LKLLSYETFD EIEKILYEKE LLSNFVRMAP       240
     QSDNEPHLAG NDQSKSSNDD PTGYTDKLET LNKPLLSKHG KVLRNFTLVD KRSELKSKVK       300
     GYGQYGPTMS VEEFLEQEWE QGRVLQGGEE PTKEEIEALN EDNMEWQDKE TYKAREWDEF       360
     KEENPKGSGN TMNRG                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page