(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE326

CAGLA1_12.PE326      Location/Qualifiers
FT   CDS             complement(749980..751392)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172710" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438997"
FT                   /locus_tag="CAGL0M07447g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62648.1"
FT                   /db_xref="HOGENOM:HBG027398"
FT                   /db_xref="HOGENOM:HBG696796"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="UniParc:UPI00003B711E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJC2"
FT                   /transl_table=1
FT                   /translation="MSLPRRCMTSDKGTFGAYTAEERWPIIVQNAIDDVDAELKDIKDR
FT                   GDDSEQILEDGELLKKQLIEFREEILANTPLRKFTEQEIAIANIPLSFNETLDETADIN
FT                   KSWISSEWLFTEVYMYRRINVLFKSKKSPFWQEFDIFDRLKQSTFKASLHGVVELAIRY
FT                   KKLSHELQSLDLSSGESQEVLKILFKEFTEVSLWGNATDLSLLTSISLEDIKSIQGAKA
FT                   REASESKIVVNDTDKAWDALISSKPGNRRVDFVLDNSGFELYADFLMGAFLLRSKLASK
FT                   CIFHAKDMPYMVSDVMMKDFETLLKDLEDRDFFPVTSGSEDDLALNDLATDIRDFIKEG
FT                   SFEFRTDSFWTTELDYWNIDPSEKKYHGAEIHNDFTKSNLVIFKGDLNYRKLTGDRTWP
FT                   RTTSWEAAIGPLAHNGVPTLSLRTCKATVQVALPEGKDEELSAVWEKDHPGQGSWWCCS
FT                   GKWAVICFSDGK"
     MSLPRRCMTS DKGTFGAYTA EERWPIIVQN AIDDVDAELK DIKDRGDDSE QILEDGELLK        60
     KQLIEFREEI LANTPLRKFT EQEIAIANIP LSFNETLDET ADINKSWISS EWLFTEVYMY       120
     RRINVLFKSK KSPFWQEFDI FDRLKQSTFK ASLHGVVELA IRYKKLSHEL QSLDLSSGES       180
     QEVLKILFKE FTEVSLWGNA TDLSLLTSIS LEDIKSIQGA KAREASESKI VVNDTDKAWD       240
     ALISSKPGNR RVDFVLDNSG FELYADFLMG AFLLRSKLAS KCIFHAKDMP YMVSDVMMKD       300
     FETLLKDLED RDFFPVTSGS EDDLALNDLA TDIRDFIKEG SFEFRTDSFW TTELDYWNID       360
     PSEKKYHGAE IHNDFTKSNL VIFKGDLNYR KLTGDRTWPR TTSWEAAIGP LAHNGVPTLS       420
     LRTCKATVQV ALPEGKDEEL SAVWEKDHPG QGSWWCCSGK WAVICFSDGK                  470
//

If you have problems or comments...

PBIL Back to PBIL home page