(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE327

CAGLA1_12.PE327      Location/Qualifiers
FT   CDS             752098..753375
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000038427" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438998"
FT                   /locus_tag="CAGL0M07469g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="zinc ion binding"
FT                   /biological_process="peroxisome organization"
FT                   /cellular_component="peroxisomal membrane"
FT                   /protein_id="CAG62649.1"
FT                   /db_xref="GO:0005778"
FT                   /db_xref="GO:0007031"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG189863"
FT                   /db_xref="HOGENOM:HBG203384"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI00003B711F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJC1"
FT                   /transl_table=1
FT                   /translation="MSFFSNLPATATSNSGEGVSSLFPTIFEIVSSQEIDELLPASIRY
FT                   ILTNYWISRYPSWTTLQVNNYFEEWFGVGVQGLVEWYHIDKYNSTFVDKFYGLQRFNNS
FT                   DPVLTQAQAIRQAREAGNPNLQWPKSLQLTNGQKRVVFLQKIILPYISHRLSEVYNKLK
FT                   SRIAMLSTELDDETGGADKKTKLKRFVIKWFVRLYPLWNSLTSLLNMVVKLAFLTGRTG
FT                   SMTFLEYLFKIEYTRMTLPLENGSISPSKTLKNNERPTRTNMSSIRGIFESAIGSLGGM
FT                   AGLTGSQLFPAFIFMLRVYQWWNTEDLTTKLQKKLNDIDKDIPRPPNAHISEEASNDSF
FT                   EDSEMSQISEKIGTKKSDICPICKDSIENPCVLETGYVTCYACALDYIPKHEGRCPVTG
FT                   KRLLGCQFDSESGEWKVVTGIRRLLV"
     MSFFSNLPAT ATSNSGEGVS SLFPTIFEIV SSQEIDELLP ASIRYILTNY WISRYPSWTT        60
     LQVNNYFEEW FGVGVQGLVE WYHIDKYNST FVDKFYGLQR FNNSDPVLTQ AQAIRQAREA       120
     GNPNLQWPKS LQLTNGQKRV VFLQKIILPY ISHRLSEVYN KLKSRIAMLS TELDDETGGA       180
     DKKTKLKRFV IKWFVRLYPL WNSLTSLLNM VVKLAFLTGR TGSMTFLEYL FKIEYTRMTL       240
     PLENGSISPS KTLKNNERPT RTNMSSIRGI FESAIGSLGG MAGLTGSQLF PAFIFMLRVY       300
     QWWNTEDLTT KLQKKLNDID KDIPRPPNAH ISEEASNDSF EDSEMSQISE KIGTKKSDIC       360
     PICKDSIENP CVLETGYVTC YACALDYIPK HEGRCPVTGK RLLGCQFDSE SGEWKVVTGI       420
     RRLLV                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page