(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE330

CAGLA1_12.PE330      Location/Qualifiers
FT   CDS             756457..757920
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000200714" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439000"
FT                   /locus_tag="CAGL0M07546g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /biological_process="tRNA modification"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62652.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006400"
FT                   /db_xref="HOGENOM:HBG001389"
FT                   /db_xref="HOGENOM:HBG746795"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="UniParc:UPI00003B7122"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJB8"
FT                   /transl_table=1
FT                   /translation="MVGIRFLSHTRQRLPTIYSMVTPRAKSAVSVIRVSGDKAQYVYRK
FT                   LTRRDDVPRSRQACLRGLYNGDNELIDRALVLYFKSPGSFTGEDVVEFQVHGGRAVSES
FT                   VLSAIGSLNNRDQDVEIRMADRGEFSRRSFLNGKADLTGLEGINTLINADTEAQRRAAM
FT                   GSFTGKNKALFNRWRDIAIQNSAQLTAIIDFSEDSDFADEYTAVMAEVRQELMGLRTEI
FT                   GNFIARVTKASIVENGINMTLLGAPNVGKSSLLNQIASDDISIVSDIPGTTRDIVSSIV
FT                   NINGYKVNLFDTAGIRVDTTDPIEKMGIEKAFKRIGSSDICICVIDGTQPLPLNVLDLL
FT                   KSSDLSGSEIIFVVNKIDIVDDSCKLSKIQQYIGNNLTGCKICFVSCLKSTGIDELVTV
FT                   LTGKFKTLTQNEENEDPIIVSDRVKEILEKDVLYGIDQFLQIQDDMHDIVIATEHLRYV
FT                   IDGIGKITGEVIGLEEVLDVVFSKFCVGK"
     MVGIRFLSHT RQRLPTIYSM VTPRAKSAVS VIRVSGDKAQ YVYRKLTRRD DVPRSRQACL        60
     RGLYNGDNEL IDRALVLYFK SPGSFTGEDV VEFQVHGGRA VSESVLSAIG SLNNRDQDVE       120
     IRMADRGEFS RRSFLNGKAD LTGLEGINTL INADTEAQRR AAMGSFTGKN KALFNRWRDI       180
     AIQNSAQLTA IIDFSEDSDF ADEYTAVMAE VRQELMGLRT EIGNFIARVT KASIVENGIN       240
     MTLLGAPNVG KSSLLNQIAS DDISIVSDIP GTTRDIVSSI VNINGYKVNL FDTAGIRVDT       300
     TDPIEKMGIE KAFKRIGSSD ICICVIDGTQ PLPLNVLDLL KSSDLSGSEI IFVVNKIDIV       360
     DDSCKLSKIQ QYIGNNLTGC KICFVSCLKS TGIDELVTVL TGKFKTLTQN EENEDPIIVS       420
     DRVKEILEKD VLYGIDQFLQ IQDDMHDIVI ATEHLRYVID GIGKITGEVI GLEEVLDVVF       480
     SKFCVGK                                                                 487
//

If you have problems or comments...

PBIL Back to PBIL home page