(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE331

CAGLA1_12.PE331      Location/Qualifiers
FT   CDS             complement(758110..758607)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233454" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439001"
FT                   /locus_tag="CAGL0M07568g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="CAG62653.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG492183"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI00003B7123"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJB7"
FT                   /transl_table=1
FT                   /translation="MSKTAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPP
FT                   DTPYAGGVFNAQLEFPKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYE
FT                   SAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSILKSL
FT                   GF"
     MSKTAQKRLY KELQQLIKDS PPGIVAGPKS DDNLFVWDCL IQGPPDTPYA GGVFNAQLEF        60
     PKDYPLSPPK LTFTPSILHP NIYPNGEVCI SILHSPGDDP NMYESAEERW SPVQSVEKIL       120
     LSVMSMLSEP NIESGANIDA CILWRDNRAE FEKQVKLSIL KSLGF                       165
//

If you have problems or comments...

PBIL Back to PBIL home page