(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE332

CAGLA1_12.PE332      Location/Qualifiers
FT   CDS             758940..760310
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066040" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439002"
FT                   /locus_tag="CAGL0M07590g"
FT                   /product="Similar to uniprot|P35192 Saccharomyces
FT                   cerevisiae YMR021c metal binding activator "
FT                   /function="DNA binding"
FT                   /function="copper ion binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62654.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG124093"
FT                   /db_xref="HOGENOM:HBG203382"
FT                   /db_xref="InterPro:IPR001083"
FT                   /db_xref="UniParc:UPI00003B7124"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJB6"
FT                   /transl_table=1
FT                   /translation="MIIFKNDKYACVKCIRGHRSSLCVHTGRMLVKVRNRGRKKGIDVR
FT                   DAIVVGDIHRKRSCECASGHAGDDSKQYGAPNADVSRPHESGLNSTCVGMNKQPILFVR
FT                   AKKVLKAQLIGGELKEMSEVDMSRLEVDTSDDETVATTTTVPKVEILDNNVLNVTQGNI
FT                   DDDMVLVDDTKNFAGASIGELIDEQLSSINVEPTGSHCCGSQPHGIDPMKTTTVTAAAT
FT                   ETEKYPFFQLLTKRGVYLSTQCSCSAANCACSNCLIHRTEEEINNYIEASGVPLTNLDS
FT                   STSLQATPEIESPRPSCMCKPEECTCDGCDIHTIEVVPFQRIVIHGLINTRLTKKTLIQ
FT                   YRKKLIGQKYWWDYCMVYIPCLRCNNFDGLDIVGFFDNIIKEHGHELEDAKEKVDAGSI
FT                   QNLTSQAENFIMNMNNSIDNGVSSNTTNNMNNINDTRLQSHYANLVKTEGTISPMFM"
     MIIFKNDKYA CVKCIRGHRS SLCVHTGRML VKVRNRGRKK GIDVRDAIVV GDIHRKRSCE        60
     CASGHAGDDS KQYGAPNADV SRPHESGLNS TCVGMNKQPI LFVRAKKVLK AQLIGGELKE       120
     MSEVDMSRLE VDTSDDETVA TTTTVPKVEI LDNNVLNVTQ GNIDDDMVLV DDTKNFAGAS       180
     IGELIDEQLS SINVEPTGSH CCGSQPHGID PMKTTTVTAA ATETEKYPFF QLLTKRGVYL       240
     STQCSCSAAN CACSNCLIHR TEEEINNYIE ASGVPLTNLD SSTSLQATPE IESPRPSCMC       300
     KPEECTCDGC DIHTIEVVPF QRIVIHGLIN TRLTKKTLIQ YRKKLIGQKY WWDYCMVYIP       360
     CLRCNNFDGL DIVGFFDNII KEHGHELEDA KEKVDAGSIQ NLTSQAENFI MNMNNSIDNG       420
     VSSNTTNNMN NINDTRLQSH YANLVKTEGT ISPMFM                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page