(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE337

CAGLA1_12.PE337      Location/Qualifiers
FT   CDS             772364..773746
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141906" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501424"
FT                   /locus_tag="CAGL0M07700g"
FT                   /product="Similar to uniprot|P20048 Saccharomyces
FT                   cerevisiae YMR013c dolichol kinase "
FT                   /function="kinase activity"
FT                   /protein_id="CAG62659.2"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG398767"
FT                   /db_xref="HOGENOM:HBG429566"
FT                   /db_xref="UniParc:UPI00017BD8F3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJB1"
FT                   /transl_table=1
FT                   /translation="MEVIPQLWQLVMLSVPFMYCYDNVMELLCSSVVVQMVIVVHLVCF
FT                   VLRRKLFDDFYRIYLPFLVSFTFCDRTLTELNMIMSTTAVIPSNYTPIHLVGLIFQAGL
FT                   MKIGMHNYDYISGVKCLVANYLLVNWLEDIGQLKTLDQIDCNLFGILLTDCLMINNATA
FT                   PNYLLVLKGAMTSVMIIIVVNHFLTRLIPSLSNSIVLAGNFLVLFPILVNHLIDFSNEK
FT                   ITSPALWLIDFILESEIRQYIMLSWVIVLVVFIPLVILFKSKISLNTSRKIWHFVIFLL
FT                   IVEPFHLDPEFVKISLCGIIPCFLSVEYLRYLKIEPYGEHLDFFLRSFADYRDQRGPLI
FT                   VSYIYLITGITIPLLLFESPVGLVSLGVGDSLASIVGKKVGRMHWKGTNKTIEGTVAFI
FT                   VGTTFISWILQRYFNYFSTIDIFKILVICTTGGVLEGNSELNDNILIPLFMVSMEKLLA
FT                   QS"
     MEVIPQLWQL VMLSVPFMYC YDNVMELLCS SVVVQMVIVV HLVCFVLRRK LFDDFYRIYL        60
     PFLVSFTFCD RTLTELNMIM STTAVIPSNY TPIHLVGLIF QAGLMKIGMH NYDYISGVKC       120
     LVANYLLVNW LEDIGQLKTL DQIDCNLFGI LLTDCLMINN ATAPNYLLVL KGAMTSVMII       180
     IVVNHFLTRL IPSLSNSIVL AGNFLVLFPI LVNHLIDFSN EKITSPALWL IDFILESEIR       240
     QYIMLSWVIV LVVFIPLVIL FKSKISLNTS RKIWHFVIFL LIVEPFHLDP EFVKISLCGI       300
     IPCFLSVEYL RYLKIEPYGE HLDFFLRSFA DYRDQRGPLI VSYIYLITGI TIPLLLFESP       360
     VGLVSLGVGD SLASIVGKKV GRMHWKGTNK TIEGTVAFIV GTTFISWILQ RYFNYFSTID       420
     IFKILVICTT GGVLEGNSEL NDNILIPLFM VSMEKLLAQS                             460
//

If you have problems or comments...

PBIL Back to PBIL home page