(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE338

CAGLA1_12.PE338      Location/Qualifiers
FT   CDS             complement(774048..777851)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000154574" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439005"
FT                   /gene_name="TIF31"
FT                   /locus_tag="CAGL0M07722g"
FT                   /product="Protein TIF31 homolog "
FT                   /function="binding"
FT                   /protein_id="CAG62660.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG058185"
FT                   /db_xref="HOGENOM:HBG203377"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI00003B712A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJB0"
FT                   /transl_table=1
FT                   /translation="MSQPSDIVKVIVALPTLSKKPQQGKKKKSKELEEITLQFRKDSKL
FT                   QNVLDFLSIAPATKYFTNYNLKNSTGDLLLSSEEKTLRELCSDKDEYKVALELKPYNQY
FT                   QALKHVLTSRDFFGFASETEDGLSNVAVSTGSKFYKLPLKEIKEKSPENEDKDTENKKP
FT                   TSMNVTDEEKVEFNHMVHGLFETLKKEKKVLLKDLMNTDTSVVTPCLRSINFSPYNPVP
FT                   AFYRTKGHLFYLQIVTLEGESLQVTAIPSGFYINKSTTSKFDPSPKENDGHVDTVHYTL
FT                   YDLLASSSKNFVTHISSLEKKFDDLESVTYVRPACTTLNKPWLIPAIPTNGPDYLRTQI
FT                   DSFNFEPERNFNDEFQSIKEIPTNTLQARIESERIFAKLTHEFTINATKGAMDILYGNG
FT                   TAMNPDSPLEEQIFLKNNIFYSFVGDLNQTYADKGGDEAAIASANQDLRTLNMLTRLNL
FT                   PNIHHLLTTIVDFGGKRILAQTPVPGLLSPMGVKITTNEETKEETVSELSSDICVKYGL
FT                   DENEKKVVFNEEFDEILNDQFAKSFHLKKHTIQGTELVFSSQSKGIVGSDKRHYILDLA
FT                   NTYPLDVEFAKENFDDVKEASKKYPHRQTLIRPELVEKWWATKIENDKVELVKAYEENL
FT                   YSYNPDAYQVPGVEDETVVEISKYLNEEIIPNVVQDYLNGNIISPYNGEHLADTFHKNG
FT                   VNMRYLGKFANLVKEELRKQEEAHEAKLAQVIVDNKEYEEWEKSYLQKIETMIKERQAK
FT                   INKLVQEGKEVPKELTEDLKLDDNEIKKPSTEKPVVVSYDELVPLIKTAELEIISRSLK
FT                   HILRKYSRSLPPIVIPALISFVFNLLFGTTYNPAPAVESVDPLYPVDQYEFKNLTHDTL
FT                   LKEIEQEAVVRYRYELEGDWFAEHELYPFTLIRSICNKFGVQLLNKDYFFSTEQLEEYK
FT                   QSLDKKSRAKYVAPLTTFSVSDLTVIPKIKAIDYSSPISEELWSQGASIINENQKDGLT
FT                   LLAQSIGFKEEVNSILHSSVAEKYLTLSTIYNKLGLNAEAIAFCRKSCAIYERVCGVDS
FT                   FELLRALTNLATLEFANESPYNVALIYQRIIQTVSGYGLDKIHHPIFTNIFNYLEQLSL
FT                   GVQDAKLAVEVLKSLGDFLVSIDGTESLPYAYIKSKLGNLLAADNRFSDALNQIKVAER
FT                   IFTKELGTNHGSTAQARQWVDGLTNLIKDVNQKKQLQQDQTAASGLKQQPQKSKSGHNK
FT                   KETTNPDLADKSVDELLSFIEGEDGKSSKTTKKSKSKGKNKK"
     MSQPSDIVKV IVALPTLSKK PQQGKKKKSK ELEEITLQFR KDSKLQNVLD FLSIAPATKY        60
     FTNYNLKNST GDLLLSSEEK TLRELCSDKD EYKVALELKP YNQYQALKHV LTSRDFFGFA       120
     SETEDGLSNV AVSTGSKFYK LPLKEIKEKS PENEDKDTEN KKPTSMNVTD EEKVEFNHMV       180
     HGLFETLKKE KKVLLKDLMN TDTSVVTPCL RSINFSPYNP VPAFYRTKGH LFYLQIVTLE       240
     GESLQVTAIP SGFYINKSTT SKFDPSPKEN DGHVDTVHYT LYDLLASSSK NFVTHISSLE       300
     KKFDDLESVT YVRPACTTLN KPWLIPAIPT NGPDYLRTQI DSFNFEPERN FNDEFQSIKE       360
     IPTNTLQARI ESERIFAKLT HEFTINATKG AMDILYGNGT AMNPDSPLEE QIFLKNNIFY       420
     SFVGDLNQTY ADKGGDEAAI ASANQDLRTL NMLTRLNLPN IHHLLTTIVD FGGKRILAQT       480
     PVPGLLSPMG VKITTNEETK EETVSELSSD ICVKYGLDEN EKKVVFNEEF DEILNDQFAK       540
     SFHLKKHTIQ GTELVFSSQS KGIVGSDKRH YILDLANTYP LDVEFAKENF DDVKEASKKY       600
     PHRQTLIRPE LVEKWWATKI ENDKVELVKA YEENLYSYNP DAYQVPGVED ETVVEISKYL       660
     NEEIIPNVVQ DYLNGNIISP YNGEHLADTF HKNGVNMRYL GKFANLVKEE LRKQEEAHEA       720
     KLAQVIVDNK EYEEWEKSYL QKIETMIKER QAKINKLVQE GKEVPKELTE DLKLDDNEIK       780
     KPSTEKPVVV SYDELVPLIK TAELEIISRS LKHILRKYSR SLPPIVIPAL ISFVFNLLFG       840
     TTYNPAPAVE SVDPLYPVDQ YEFKNLTHDT LLKEIEQEAV VRYRYELEGD WFAEHELYPF       900
     TLIRSICNKF GVQLLNKDYF FSTEQLEEYK QSLDKKSRAK YVAPLTTFSV SDLTVIPKIK       960
     AIDYSSPISE ELWSQGASII NENQKDGLTL LAQSIGFKEE VNSILHSSVA EKYLTLSTIY      1020
     NKLGLNAEAI AFCRKSCAIY ERVCGVDSFE LLRALTNLAT LEFANESPYN VALIYQRIIQ      1080
     TVSGYGLDKI HHPIFTNIFN YLEQLSLGVQ DAKLAVEVLK SLGDFLVSID GTESLPYAYI      1140
     KSKLGNLLAA DNRFSDALNQ IKVAERIFTK ELGTNHGSTA QARQWVDGLT NLIKDVNQKK      1200
     QLQQDQTAAS GLKQQPQKSK SGHNKKETTN PDLADKSVDE LLSFIEGEDG KSSKTTKKSK      1260
     SKGKNKK                                                                1267
//

If you have problems or comments...

PBIL Back to PBIL home page