(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE34

CAGLA1_12.PE34       Location/Qualifiers
FT   CDS             complement(95426..96373)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000094497" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436693"
FT                   /gene_name="MRPL4"
FT                   /locus_tag="CAGL0M00858g"
FT                   /product="54S ribosomal protein L4, mitochondrial "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="mitochondrial ribosome"
FT                   /protein_id="CAG62359.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005761"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG059094"
FT                   /db_xref="HOGENOM:HBG398135"
FT                   /db_xref="InterPro:IPR010729"
FT                   /db_xref="UniParc:UPI00003B7002"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK61"
FT                   /transl_table=1
FT                   /translation="MLRRQFHSGCVQLARTRYTKPKPKNTETRAKEQIRLPTQQTHHSN
FT                   ELRIQPPIPPSTKNIVVPDDHPLWQFFSDKKFMRRPEDLDTTSRAWSIPELRRKSFEDL
FT                   HSLWYTCLKERNILARENHLLKNAAKNNRNDYEDISEKIRTTMWRIRHVLSERDWAFKR
FT                   ARETFAQNKELQDNLVDDFKKEFLELDSSEDEQAFEMLTRFQEALFGIHEVIEDNVVDR
FT                   KFVDGLKLVATLKLQRFQSRNDSINAILEESDGQINDVGEAFVVFTADNNLKAVEEACD
FT                   AIKELRQGENGVSRFDELPTVRGYLKRLVSATTV"
     MLRRQFHSGC VQLARTRYTK PKPKNTETRA KEQIRLPTQQ THHSNELRIQ PPIPPSTKNI        60
     VVPDDHPLWQ FFSDKKFMRR PEDLDTTSRA WSIPELRRKS FEDLHSLWYT CLKERNILAR       120
     ENHLLKNAAK NNRNDYEDIS EKIRTTMWRI RHVLSERDWA FKRARETFAQ NKELQDNLVD       180
     DFKKEFLELD SSEDEQAFEM LTRFQEALFG IHEVIEDNVV DRKFVDGLKL VATLKLQRFQ       240
     SRNDSINAIL EESDGQINDV GEAFVVFTAD NNLKAVEEAC DAIKELRQGE NGVSRFDELP       300
     TVRGYLKRLV SATTV                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page