(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE341

CAGLA1_12.PE341      Location/Qualifiers
FT   CDS             join(complement(784445..784724),complement(783505..784319))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044875"
FT                   /locus_tag="CAGL0M07832g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62663.1"
FT                   /db_xref="HOGENOM:HBG124096"
FT                   /db_xref="InterPro:IPR015159"
FT                   /db_xref="UniParc:UPI00003B712D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJA7"
FT                   /transl_table=1
FT                   /translation="MEQRLETEDLHSESTDISSSIDADDLLHSGDSSLGEADKQIMEWA
FT                   GKLELESIDLREKSEKLINTLTNMSQELMKVSSQLVKQLENCNHSKEEDIVDQVYKLDV
FT                   NINNQLQDWKKSFSDQLKSINHNSNLGQIKNLTECMANQEANILGAIRHNSTILKDECR
FT                   DIIKSQELAGAPKLQRAVDYLHEIMHNMSCQTESMNELLLSIDKQLHNIDLALIKEKDQ
FT                   YKVQFKAFKRSLRDMITSNRNNVEDTVVNTVQVTIERKLEDMFDKMFDQKLLGKLRLLI
FT                   TKGEIPVPEGSKLANAIPLNRHTNDYDLNGTTWTDSSSQDGPRTRARFRTKNKVTKPRK
FT                   SEISRTIIPWCEISSPPVEYTSDL"
     MEQRLETEDL HSESTDISSS IDADDLLHSG DSSLGEADKQ IMEWAGKLEL ESIDLREKSE        60
     KLINTLTNMS QELMKVSSQL VKQLENCNHS KEEDIVDQVY KLDVNINNQL QDWKKSFSDQ       120
     LKSINHNSNL GQIKNLTECM ANQEANILGA IRHNSTILKD ECRDIIKSQE LAGAPKLQRA       180
     VDYLHEIMHN MSCQTESMNE LLLSIDKQLH NIDLALIKEK DQYKVQFKAF KRSLRDMITS       240
     NRNNVEDTVV NTVQVTIERK LEDMFDKMFD QKLLGKLRLL ITKGEIPVPE GSKLANAIPL       300
     NRHTNDYDLN GTTWTDSSSQ DGPRTRARFR TKNKVTKPRK SEISRTIIPW CEISSPPVEY       360
     TSDL                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page