(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE344

CAGLA1_12.PE344      Location/Qualifiers
FT   CDS             786678..789155
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216643" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044876"
FT                   /locus_tag="CAGL0M07898g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="binding"
FT                   /protein_id="CAG62666.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG124098"
FT                   /db_xref="HOGENOM:HBG202423"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniParc:UPI00003B7130"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJA4"
FT                   /transl_table=1
FT                   /translation="MADEEVDIERLTLQEKLDHKLWKARQRGYQDLQKELEEGILDPSF
FT                   FDQLWGETGRFEQYIQDSNVVALESAVVALNSFLGKKISKIVDSGDDTIKTHAKFQVDA
FT                   WVPVLIIKPLSSTRAATKKNAMECIIKLVSLMDSVDYTISAILTKLPSVIKQPKPTAAI
FT                   INILNQILTKFQCNLLASADLLKQLLEPLPKLSSHADRNVRSETMNLIVTVFLKVDGFQ
FT                   NRALLDELLLNSLKPIQIKDMEKMIDKVKDQKPEIMPYVWEDVIAKNKQQFNVDEDGDT
FT                   VMMGSNTEPKQDNTNNNVNALDSLVAGDTILDKFPDEFHSRVESQKWKDRAEALEEFYD
FT                   HALSKLKKIDGNANENYTNLFSMYGHIISKDINVQVVTIAAESIDKICHALPKQKLTKH
FT                   LIQLVFNPLLERTKEKKPTLLDAIRKTLKTLVEHSNPVLPHNEDMLQLILQYMEHKVPQ
FT                   IRMECTSLFNYVLQLEAPGFDIHSSYLFGEISRIVPKVVKIVNDTNPSIRQVGFDCFAT
FT                   LVTLLGKRPFIDSLDKLDTQKRKKIEELINSKSRPSSGALPGTRAGATSTVLPVKRPPT
FT                   SPLKKPPTSTSPRSRVLLTSRSLTKPNFGGSQPAPVAELTTGTLTPNKRFDKAVDNGVQ
FT                   GITSNGGANYVSKFNSERERWDKERGGLLSSIKKLEDTNAELTARNFELVDKLTSFEKE
FT                   REQQNLVINSKNEENGKLLEKIDFLEMKVKELQEKLDSNLSSARTFSLGTELSVPEAKR
FT                   VVESSDDELPKRVNSLRINSRASTLSSSDQQLFSRQFSGRDDEESWKRAAEVTRKLKER
FT                   IETMKARNRELSN"
     MADEEVDIER LTLQEKLDHK LWKARQRGYQ DLQKELEEGI LDPSFFDQLW GETGRFEQYI        60
     QDSNVVALES AVVALNSFLG KKISKIVDSG DDTIKTHAKF QVDAWVPVLI IKPLSSTRAA       120
     TKKNAMECII KLVSLMDSVD YTISAILTKL PSVIKQPKPT AAIINILNQI LTKFQCNLLA       180
     SADLLKQLLE PLPKLSSHAD RNVRSETMNL IVTVFLKVDG FQNRALLDEL LLNSLKPIQI       240
     KDMEKMIDKV KDQKPEIMPY VWEDVIAKNK QQFNVDEDGD TVMMGSNTEP KQDNTNNNVN       300
     ALDSLVAGDT ILDKFPDEFH SRVESQKWKD RAEALEEFYD HALSKLKKID GNANENYTNL       360
     FSMYGHIISK DINVQVVTIA AESIDKICHA LPKQKLTKHL IQLVFNPLLE RTKEKKPTLL       420
     DAIRKTLKTL VEHSNPVLPH NEDMLQLILQ YMEHKVPQIR MECTSLFNYV LQLEAPGFDI       480
     HSSYLFGEIS RIVPKVVKIV NDTNPSIRQV GFDCFATLVT LLGKRPFIDS LDKLDTQKRK       540
     KIEELINSKS RPSSGALPGT RAGATSTVLP VKRPPTSPLK KPPTSTSPRS RVLLTSRSLT       600
     KPNFGGSQPA PVAELTTGTL TPNKRFDKAV DNGVQGITSN GGANYVSKFN SERERWDKER       660
     GGLLSSIKKL EDTNAELTAR NFELVDKLTS FEKEREQQNL VINSKNEENG KLLEKIDFLE       720
     MKVKELQEKL DSNLSSARTF SLGTELSVPE AKRVVESSDD ELPKRVNSLR INSRASTLSS       780
     SDQQLFSRQF SGRDDEESWK RAAEVTRKLK ERIETMKARN RELSN                       825
//

If you have problems or comments...

PBIL Back to PBIL home page