(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE349

CAGLA1_12.PE349      Location/Qualifiers
FT   CDS             complement(800149..801312)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065980" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044877"
FT                   /locus_tag="CAGL0M08030g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="binding"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="CAG62671.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG022580"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR023114"
FT                   /db_xref="UniParc:UPI00003B7135"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ99"
FT                   /transl_table=1
FT                   /translation="MKVYLDIAIAGEQIGRIVCELYNDKAPKAVENFHRLCVGSGSVGG
FT                   IHLTYKRSCFHRVIRNFMIQGGDLVFGKEDNLDSDKVGLGGCSIYATEEEIKDDTKELQ
FT                   CHGLFEDENVGEFDEPFLLAMANTGSPNTNSSQFFITTYPSPHLTGKHSIFGRVIHGKS
FT                   VVRTIEYGKVDKEGTPENLVVIEDCGDWDETMSIPLYNASNSTIGGDIYEEYPDDDTHF
FT                   DSEDFAAAYNASNIIKDSGSALFKIKDYQNSYYKYMKALKYVNTYIPEQDVDEKHCLLF
FT                   IELKKKLYLNICLALFNLKDYDESMKYGHYLLELDSVDDKDKAKAYYRIGNSLFAKKRY
FT                   DEALKNYRLCRDHNPDDNVIGQKIEKTENILEKEKERTKKNISKFFR"
     MKVYLDIAIA GEQIGRIVCE LYNDKAPKAV ENFHRLCVGS GSVGGIHLTY KRSCFHRVIR        60
     NFMIQGGDLV FGKEDNLDSD KVGLGGCSIY ATEEEIKDDT KELQCHGLFE DENVGEFDEP       120
     FLLAMANTGS PNTNSSQFFI TTYPSPHLTG KHSIFGRVIH GKSVVRTIEY GKVDKEGTPE       180
     NLVVIEDCGD WDETMSIPLY NASNSTIGGD IYEEYPDDDT HFDSEDFAAA YNASNIIKDS       240
     GSALFKIKDY QNSYYKYMKA LKYVNTYIPE QDVDEKHCLL FIELKKKLYL NICLALFNLK       300
     DYDESMKYGH YLLELDSVDD KDKAKAYYRI GNSLFAKKRY DEALKNYRLC RDHNPDDNVI       360
     GQKIEKTENI LEKEKERTKK NISKFFR                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page