(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE350

CAGLA1_12.PE350      Location/Qualifiers
FT   CDS             801812..805744
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044878"
FT                   /locus_tag="CAGL0M08052g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ARF guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of ARF protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62672.1"
FT                   /db_xref="GO:0005086"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032012"
FT                   /db_xref="HOGENOM:HBG124099"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="UniParc:UPI00003B7136"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ98"
FT                   /transl_table=1
FT                   /translation="MLVSDPNTIILRECRELLYVIASERQDEYIPAVPDLIGGSNEYSE
FT                   DEEDTQKAELMKGEGTEDVDDKTAVKNQLQTLIDTVLLSQTLDNIDACTIVAPFNRTLI
FT                   SPRLNREATIRTLDALEKFINFEVINVNMSNYSTAFRMLIDSLNNISFDAYDKTSDDSI
FT                   LFKTLVLLRSSITKNSFEILSDSVAYDLLKTTITLACNSKRSPLLQEYARSSIYELTAI
FT                   AFNKIRSLKSSDDTNNYINDKSLGSSTLKKYLANRSSSEEDSMGLKGDEYFNSTVDLIK
FT                   ENKYKDPNCGLPVIKRYLQLLLSLLTIDQDNKHTKQVKALGFSLIICGIEVAGKDIILF
FT                   PSLFSIVADQIFEQVLYVIRTVYDKELVKVALDLFITLTINMEPYLRPQIELTFSHICD
FT                   ILLDKSIFTGERSKKTKSELKEIFLESISIMWKRKPSYLVDAFINYDCNLNRMDLANII
FT                   SGTLCKLLTSNGNDDINTWLLSFESLEIFINFMYEMTIKNASMSTNGIKEGSDIISQKK
FT                   KKIEYLSCVDRFNKKPKEGITYFHRSGFLKTLSDKDIATFLFENKGPLNKQKIGLLLCD
FT                   PNEQKLLQSYMQNFDFRDFRLDEALRIMLSKFRLPGESQQIERIIEMFSEVYSSQNERK
FT                   NENIQPESIDSNEADSELCVSISNKNVTCDADSAFVLSYSLIMLNTDLHNPQIKTHMSF
FT                   SDYTSNLRGCYKGADFPDSFLAKLYNSIKEKEILMPEEHHGNEQLFKDDWNNLIASAFI
FT                   LTKPSSKIQEHEERTKDFTDFIGAIFETFGFSLVSAFLSTTHANQISSNNTRLFAIIEK
FT                   CGRITSIYGLSAPYNKVIDSLLKMTVLIGNLDKELRLVENDNDDYAQIEVESSTSNEAI
FT                   CVSNESIAFGRDEKAQLSYITAYKLLNLEKNNIGLLPDTLETLIEVLTILYDKHIIDMS
FT                   YIDNVNELMRCDILPRTPTEITIKKEALNRSLLSTFASYIKGDEGPSKEQISLSELTIS
FT                   LVREHNVFTALNAHPKLINSGPMKSVLSLTSNARYNSRKNYCNYNFFFLVEFLIKLCID
FT                   NNIIEECGGSMINHLENHSNTPGITTRSRYAIMIIKNLINKHLGEQDKIIIDTLTFLNS
FT                   EDKDLQENDFDLFTTLINELISHSEKNLTVLNNPLFWRALSRACEYNILIETVSSILDN
FT                   FVLNEDTDLTDQIMIHLLFIQTIHQSKALTKLLENITKLPQNYSDANVPHLIELLLNNH
FT                   DEPLRVQVEQCLVALTKECSSSEQPEPSNLVQKYYLPVLSRNITDENVVVSLVNIITTV
FT                   SNQCTDTNSWNKEELKKIMMPFVNHE"
     MLVSDPNTII LRECRELLYV IASERQDEYI PAVPDLIGGS NEYSEDEEDT QKAELMKGEG        60
     TEDVDDKTAV KNQLQTLIDT VLLSQTLDNI DACTIVAPFN RTLISPRLNR EATIRTLDAL       120
     EKFINFEVIN VNMSNYSTAF RMLIDSLNNI SFDAYDKTSD DSILFKTLVL LRSSITKNSF       180
     EILSDSVAYD LLKTTITLAC NSKRSPLLQE YARSSIYELT AIAFNKIRSL KSSDDTNNYI       240
     NDKSLGSSTL KKYLANRSSS EEDSMGLKGD EYFNSTVDLI KENKYKDPNC GLPVIKRYLQ       300
     LLLSLLTIDQ DNKHTKQVKA LGFSLIICGI EVAGKDIILF PSLFSIVADQ IFEQVLYVIR       360
     TVYDKELVKV ALDLFITLTI NMEPYLRPQI ELTFSHICDI LLDKSIFTGE RSKKTKSELK       420
     EIFLESISIM WKRKPSYLVD AFINYDCNLN RMDLANIISG TLCKLLTSNG NDDINTWLLS       480
     FESLEIFINF MYEMTIKNAS MSTNGIKEGS DIISQKKKKI EYLSCVDRFN KKPKEGITYF       540
     HRSGFLKTLS DKDIATFLFE NKGPLNKQKI GLLLCDPNEQ KLLQSYMQNF DFRDFRLDEA       600
     LRIMLSKFRL PGESQQIERI IEMFSEVYSS QNERKNENIQ PESIDSNEAD SELCVSISNK       660
     NVTCDADSAF VLSYSLIMLN TDLHNPQIKT HMSFSDYTSN LRGCYKGADF PDSFLAKLYN       720
     SIKEKEILMP EEHHGNEQLF KDDWNNLIAS AFILTKPSSK IQEHEERTKD FTDFIGAIFE       780
     TFGFSLVSAF LSTTHANQIS SNNTRLFAII EKCGRITSIY GLSAPYNKVI DSLLKMTVLI       840
     GNLDKELRLV ENDNDDYAQI EVESSTSNEA ICVSNESIAF GRDEKAQLSY ITAYKLLNLE       900
     KNNIGLLPDT LETLIEVLTI LYDKHIIDMS YIDNVNELMR CDILPRTPTE ITIKKEALNR       960
     SLLSTFASYI KGDEGPSKEQ ISLSELTISL VREHNVFTAL NAHPKLINSG PMKSVLSLTS      1020
     NARYNSRKNY CNYNFFFLVE FLIKLCIDNN IIEECGGSMI NHLENHSNTP GITTRSRYAI      1080
     MIIKNLINKH LGEQDKIIID TLTFLNSEDK DLQENDFDLF TTLINELISH SEKNLTVLNN      1140
     PLFWRALSRA CEYNILIETV SSILDNFVLN EDTDLTDQIM IHLLFIQTIH QSKALTKLLE      1200
     NITKLPQNYS DANVPHLIEL LLNNHDEPLR VQVEQCLVAL TKECSSSEQP EPSNLVQKYY      1260
     LPVLSRNITD ENVVVSLVNI ITTVSNQCTD TNSWNKEELK KIMMPFVNHE                 1310
//

If you have problems or comments...

PBIL Back to PBIL home page