(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE351

CAGLA1_12.PE351      Location/Qualifiers
FT   CDS             806323..808878
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439010"
FT                   /locus_tag="CAGL0M08074g"
FT                   /product="UPF0508 protein CAGL0M08074g "
FT                   /protein_id="CAG62673.1"
FT                   /db_xref="HOGENOM:HBG124100"
FT                   /db_xref="UniParc:UPI00003B7137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ97"
FT                   /transl_table=1
FT                   /translation="MDIHTLRSRWAYNVQLLKQLQWACTDTAKRSLNGTISNIEASSFA
FT                   NNLQKCTEALQFCIQKSLTIERTLKNYEIDVPLPVIKDVLLEQELMKYYTVILMEGCKL
FT                   IFDYSISIFRIGTEPRFMLCLIKLYLNLDSITELLGNEGNQFSDLLNSFEYQFMTQYNI
FT                   INCNTIHLDQVRDIFAKSNPLIAPPLLTVNDIEKRGYFFLSSVDLHIDNKLIEIAQLKN
FT                   GHLAVFYVNSQRQSFSTNGAKQLLKELVEGRMELLNMGRTLLFQTLKQRDMVIFLEFED
FT                   SLELVTNNSLTKKLLIQCVDKVSWCTYWKIYLENLFSEEQARTNVKASTSMLNPSHSFQ
FT                   NFKIKHTKLSELRPVSHQGIALNIPQKKSQNCQANITKSDDLEEDPGFKFAIHQSNPIN
FT                   EIYTSQTEELITSPSLNEIEYLSYDKLIALDRSLELTLSPKLLESPREANYKTVSQTFS
FT                   LDRINNISQNTPEVSDQESIVSNDELEKEPVFNPSVEDHKPQLLRKKSSLLSIFSNKNK
FT                   SKNKNNLKLEINSQMSSSNLSLNSASSSRTFFSVNSNDSTSTTVSDKYIEDSDRFQLDN
FT                   TTSILQLKVTKASCWDKSSWQVLSSFPLLLSLVKDHEAVYLTLQNPSNSGRFKFVTRIS
FT                   NIWKTTRSTAKDIQISIPTKDILATILDDLTNTTPRYQVLSLRTEEAERLKNTIDHCIN
FT                   GDMLSSISNSTTTRTLSSDASSSYMSQVSSNVSRSSTEVSDLNVHDFKSMASVKNILVL
FT                   SDIKARLHTKNNGRWCPHHIGLVNIYSLETPNNKKGIRFELTTDTRTTFQFNSKIHDLK
FT                   RLGRTGIAMIDDSEYLFEFPNNVITEQIYRYIAPSHPMI"
     MDIHTLRSRW AYNVQLLKQL QWACTDTAKR SLNGTISNIE ASSFANNLQK CTEALQFCIQ        60
     KSLTIERTLK NYEIDVPLPV IKDVLLEQEL MKYYTVILME GCKLIFDYSI SIFRIGTEPR       120
     FMLCLIKLYL NLDSITELLG NEGNQFSDLL NSFEYQFMTQ YNIINCNTIH LDQVRDIFAK       180
     SNPLIAPPLL TVNDIEKRGY FFLSSVDLHI DNKLIEIAQL KNGHLAVFYV NSQRQSFSTN       240
     GAKQLLKELV EGRMELLNMG RTLLFQTLKQ RDMVIFLEFE DSLELVTNNS LTKKLLIQCV       300
     DKVSWCTYWK IYLENLFSEE QARTNVKAST SMLNPSHSFQ NFKIKHTKLS ELRPVSHQGI       360
     ALNIPQKKSQ NCQANITKSD DLEEDPGFKF AIHQSNPINE IYTSQTEELI TSPSLNEIEY       420
     LSYDKLIALD RSLELTLSPK LLESPREANY KTVSQTFSLD RINNISQNTP EVSDQESIVS       480
     NDELEKEPVF NPSVEDHKPQ LLRKKSSLLS IFSNKNKSKN KNNLKLEINS QMSSSNLSLN       540
     SASSSRTFFS VNSNDSTSTT VSDKYIEDSD RFQLDNTTSI LQLKVTKASC WDKSSWQVLS       600
     SFPLLLSLVK DHEAVYLTLQ NPSNSGRFKF VTRISNIWKT TRSTAKDIQI SIPTKDILAT       660
     ILDDLTNTTP RYQVLSLRTE EAERLKNTID HCINGDMLSS ISNSTTTRTL SSDASSSYMS       720
     QVSSNVSRSS TEVSDLNVHD FKSMASVKNI LVLSDIKARL HTKNNGRWCP HHIGLVNIYS       780
     LETPNNKKGI RFELTTDTRT TFQFNSKIHD LKRLGRTGIA MIDDSEYLFE FPNNVITEQI       840
     YRYIAPSHPM I                                                            851
//

If you have problems or comments...

PBIL Back to PBIL home page